BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A18 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) 36 0.033 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_14186| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.22 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 33 0.24 SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) 33 0.24 SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 32 0.31 SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 32 0.41 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 32 0.41 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 32 0.41 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 32 0.41 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 32 0.41 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 32 0.41 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 32 0.41 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 32 0.41 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 32 0.41 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 32 0.41 SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 32 0.41 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 32 0.41 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 32 0.41 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 32 0.41 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 32 0.41 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 32 0.41 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 32 0.41 SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 32 0.41 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) 32 0.41 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 32 0.41 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 32 0.41 SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) 32 0.41 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 32 0.41 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 32 0.41 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 32 0.41 SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48210| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 32 0.41 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 32 0.41 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47936| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47873| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47842| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47650| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_47060| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46943| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46899| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 32 0.41 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46559| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 32 0.41 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 32 0.41 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46255| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46237| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_46079| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45828| Best HMM Match : S-antigen (HMM E-Value=0.0095) 32 0.41 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45770| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45428| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45376| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45360| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44882| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 32 0.41 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 32 0.41 SB_44716| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44551| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44440| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 32 0.41 SB_44121| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 32 0.41 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43812| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 32 0.41 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 32 0.41 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43415| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43235| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 32 0.41 SB_43116| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 32 0.41 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 32 0.41 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42148| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 32 0.41 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41772| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41652| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41597| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41534| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41390| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40755| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40748| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40671| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40647| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40555| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40354| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39915| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39901| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39749| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39688| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39619| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39535| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39117| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 32 0.41 SB_39027| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38970| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 32 0.41 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 32 0.41 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 32 0.41 SB_38657| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38472| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38131| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38069| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_38008| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 32 0.41 SB_37882| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37739| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37640| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37631| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37441| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37409| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37176| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 32 0.41 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36766| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36634| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36591| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36255| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36142| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36100| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35967| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35870| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35723| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35330| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35236| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_35015| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34995| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34882| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34723| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 32 0.41 SB_34164| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34076| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33847| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33842| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33832| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33796| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 32 0.41 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33225| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32681| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 32 0.41 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 32 0.41 SB_32505| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 32 0.41 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 32 0.41 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 32 0.41 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 32 0.41 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31346| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31342| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31136| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_30897| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 >SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) Length = 71 Score = 35.5 bits (78), Expect = 0.033 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 506 LIKHACRSTLEDHGHSCFLCE 568 +I H R+ + +HGHSCFLCE Sbjct: 36 IIDHGYRARIRNHGHSCFLCE 56 >SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 34.7 bits (76), Expect = 0.058 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 461 TFHTLTDTHSTAKLPLIKHACRSTLEDHGHSCFLCE 568 T T+ T +T++ R+ + +HGHSCFLCE Sbjct: 135 TSQTIPTTRATSEAMPKTRGYRARIRNHGHSCFLCE 170 >SB_14186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.9 bits (74), Expect = 0.10 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 540 IMVIAVSCVNGEWDAPCXGAL 602 +M + +NGEWDAPC GAL Sbjct: 41 VMTTPLRSLNGEWDAPCSGAL 61 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 33.5 bits (73), Expect = 0.13 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 515 HACRSTLEDHGHSCFLCE 568 H R+ + +HGHSCFLCE Sbjct: 148 HGYRARIRNHGHSCFLCE 165 >SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 494 AKLPLIKHACRSTLEDHGHSCFLCE 568 A + L K R+ + +HGHSCFLCE Sbjct: 48 ADVELKKGGYRARIRNHGHSCFLCE 72 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 506 LIKHACRSTLEDHGHSCFLCE 568 L K R+ + +HGHSCFLCE Sbjct: 652 LYKKGYRARIRNHGHSCFLCE 672 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect(2) = 0.22 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 551 YDHDPLESTCRHA 513 Y+ DPLESTCRHA Sbjct: 53 YEGDPLESTCRHA 65 Score = 21.8 bits (44), Expect(2) = 0.22 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 563 TGNSYDHD 540 +GNSYDHD Sbjct: 16 SGNSYDHD 23 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 578 PFAIHTGNSYDHDPLESTCRHA 513 P A H G+ DPLESTCRHA Sbjct: 63 PEAAHLGDLLRGDPLESTCRHA 84 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +3 Query: 555 VSCVNGEWDAPCXGAL 602 V +NGEWDAPC GAL Sbjct: 52 VRSLNGEWDAPCSGAL 67 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 506 LIKHACRSTLEDHGHSCFLCE 568 L K R+ + +HGHSCFLCE Sbjct: 129 LEKQGYRARIRNHGHSCFLCE 149 >SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) Length = 148 Score = 32.7 bits (71), Expect = 0.24 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 497 KLPLIKHACRSTLEDHGHSCFLCE 568 K ++ R+ + +HGHSCFLCE Sbjct: 110 KTKMMSQGYRARIRNHGHSCFLCE 133 >SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 488 STAKLPLIKHACRSTLEDHGHSCFLCE 568 +T P+ R+ + +HGHSCFLCE Sbjct: 58 ATISTPIKIDGYRARIRNHGHSCFLCE 84 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 32.3 bits (70), Expect = 0.31 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 7/32 (21%) Frame = +2 Query: 494 AKLP-LIKHACRST------LEDHGHSCFLCE 568 AKLP L+ + RST + +HGHSCFLCE Sbjct: 202 AKLPDLVTRSTRSTRGYRARIRNHGHSCFLCE 233 >SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 458 GTFHTLTDTHSTAKLPLIKHACRSTLEDHGHSCFLCE 568 G++ LT ST P + R+ + +HGHSCFLCE Sbjct: 55 GSWVALTVEGSTLANP---NGYRARIRNHGHSCFLCE 88 >SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 32.3 bits (70), Expect = 0.31 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +2 Query: 509 IKHACRSTLEDHGHSCFLCE 568 +++ R+ + +HGHSCFLCE Sbjct: 32 VQNGYRARIRNHGHSCFLCE 51 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 82 LNGEWDAPCSGAL 94 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 91 LNGEWDAPCSGAL 103 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 83 LNGEWDAPCSGAL 95 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 109 LNGEWDAPCSGAL 121 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 89 LNGEWDAPCSGAL 101 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 114 LNGEWDAPCSGAL 126 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 85 LNGEWDAPCSGAL 97 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 105 LNGEWDAPCSGAL 117 >SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) Length = 751 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 524 LNGEWDAPCSGAL 536 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 117 LNGEWDAPCSGAL 129 >SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 55 LNGEWDAPCSGAL 67 >SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 93 LNGEWDAPCSGAL 105 >SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 82 LNGEWDAPCSGAL 94 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 97 LNGEWDAPCSGAL 109 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 106 LNGEWDAPCSGAL 118 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 100 LNGEWDAPCSGAL 112 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 116 LNGEWDAPCSGAL 128 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 104 LNGEWDAPCSGAL 116 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 87 LNGEWDAPCSGAL 99 >SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 263 LNGEWDAPCSGAL 275 >SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 158 LNGEWDAPCSGAL 170 >SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 94 LNGEWDAPCSGAL 106 >SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 428 LNGEWDAPCSGAL 440 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 154 LNGEWDAPCSGAL 166 >SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 130 LNGEWDAPCSGAL 142 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 86 LNGEWDAPCSGAL 98 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 55 LNGEWDAPCSGAL 67 >SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 85 LNGEWDAPCSGAL 97 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 150 LNGEWDAPCSGAL 162 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 92 LNGEWDAPCSGAL 104 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 387 LNGEWDAPCSGAL 399 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 127 LNGEWDAPCSGAL 139 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 97 LNGEWDAPCSGAL 109 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 106 LNGEWDAPCSGAL 118 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 90 LNGEWDAPCSGAL 102 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 181 LNGEWDAPCSGAL 193 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 110 LNGEWDAPCSGAL 122 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 86 LNGEWDAPCSGAL 98 >SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 190 LNGEWDAPCSGAL 202 >SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 107 LNGEWDAPCSGAL 119 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 81 LNGEWDAPCSGAL 93 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 120 LNGEWDAPCSGAL 132 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 82 LNGEWDAPCSGAL 94 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 114 LNGEWDAPCSGAL 126 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 103 LNGEWDAPCSGAL 115 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 116 LNGEWDAPCSGAL 128 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 112 LNGEWDAPCSGAL 124 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 303 LNGEWDAPCSGAL 315 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 97 LNGEWDAPCSGAL 109 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 83 LNGEWDAPCSGAL 95 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 84 LNGEWDAPCSGAL 96 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 148 LNGEWDAPCSGAL 160 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 161 LNGEWDAPCSGAL 173 >SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 105 LNGEWDAPCSGAL 117 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 569 IHTGNSYDHDPLESTCRHA 513 +H G D DPLESTCRHA Sbjct: 15 LHPGVIRDGDPLESTCRHA 33 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 84 LNGEWDAPCSGAL 96 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 81 LNGEWDAPCSGAL 93 >SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 443 LNGEWDAPCSGAL 455 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 92 LNGEWDAPCSGAL 104 >SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 101 LNGEWDAPCSGAL 113 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 83 LNGEWDAPCSGAL 95 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 166 LNGEWDAPCSGAL 178 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 102 LNGEWDAPCSGAL 114 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 112 LNGEWDAPCSGAL 124 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 115 LNGEWDAPCSGAL 127 >SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 461 LNGEWDAPCSGAL 473 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 158 LNGEWDAPCSGAL 170 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 114 LNGEWDAPCSGAL 126 >SB_54117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 84 LNGEWDAPCSGAL 96 >SB_54092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 103 LNGEWDAPCSGAL 115 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 93 LNGEWDAPCSGAL 105 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 96 LNGEWDAPCSGAL 108 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 208 LNGEWDAPCSGAL 220 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_53629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 112 LNGEWDAPCSGAL 124 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 99 LNGEWDAPCSGAL 111 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 101 LNGEWDAPCSGAL 113 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 110 LNGEWDAPCSGAL 122 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_53123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_52872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 89 LNGEWDAPCSGAL 101 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) Length = 129 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 85 LNGEWDAPCSGAL 97 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 232 LNGEWDAPCSGAL 244 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 81 LNGEWDAPCSGAL 93 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 87 LNGEWDAPCSGAL 99 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 101 LNGEWDAPCSGAL 113 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 98 LNGEWDAPCSGAL 110 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 103 LNGEWDAPCSGAL 115 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 81 LNGEWDAPCSGAL 93 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 82 LNGEWDAPCSGAL 94 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 96 LNGEWDAPCSGAL 108 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 86 LNGEWDAPCSGAL 98 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 88 LNGEWDAPCSGAL 100 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 131 LNGEWDAPCSGAL 143 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 387 LNGEWDAPCSGAL 399 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_51754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 137 LNGEWDAPCSGAL 149 >SB_51567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 156 LNGEWDAPCSGAL 168 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_51356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_51272| Best HMM Match : SMC_hinge (HMM E-Value=6.3) Length = 93 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 50 LNGEWDAPCSGAL 62 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 87 LNGEWDAPCSGAL 99 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 133 LNGEWDAPCSGAL 145 >SB_51070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 83 LNGEWDAPCSGAL 95 >SB_50749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 341 LNGEWDAPCSGAL 353 >SB_50634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 82 LNGEWDAPCTGAL 94 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 104 LNGEWDAPCSGAL 116 >SB_50512| Best HMM Match : Kelch_1 (HMM E-Value=0.17) Length = 119 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 75 LNGEWDAPCSGAL 87 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 105 LNGEWDAPCSGAL 117 >SB_50488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_50482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 83 LNGEWDAPCSGAL 95 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 458 LNGEWDAPCSGAL 470 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 142 LNGEWDAPCSGAL 154 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 98 LNGEWDAPCSGAL 110 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 90 LNGEWDAPCSGAL 102 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_50012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_49975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 89 LNGEWDAPCSGAL 101 >SB_49917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 44 LNGEWDAPCSGAL 56 >SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) Length = 143 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 99 LNGEWDAPCSGAL 111 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 140 LNGEWDAPCSGAL 152 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 90 LNGEWDAPCSGAL 102 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 258 LNGEWDAPCSGAL 270 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 90 LNGEWDAPCSGAL 102 >SB_49761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_49678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 38 LNGEWDAPCSGAL 50 >SB_49547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_49509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 85 LNGEWDAPCSGAL 97 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 90 LNGEWDAPCSGAL 102 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 194 LNGEWDAPCSGAL 206 >SB_49332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 45 LNGEWDAPCSGAL 57 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 98 LNGEWDAPCSGAL 110 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 92 LNGEWDAPCSGAL 104 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 82 LNGEWDAPCSGAL 94 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 102 LNGEWDAPCSGAL 114 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 242 LNGEWDAPCSGAL 254 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 99 LNGEWDAPCSGAL 111 >SB_48922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_48921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_48874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_48840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 100 LNGEWDAPCSGAL 112 >SB_48531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 79 LNGEWDAPCSGAL 91 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 133 LNGEWDAPCSGAL 145 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 96 LNGEWDAPCSGAL 108 >SB_48210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) Length = 241 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 198 LNGEWDAPCSGAL 210 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 234 LNGEWDAPCSGAL 246 >SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 75 LNGEWDAPCSGAL 87 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 104 LNGEWDAPCSGAL 116 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 114 LNGEWDAPCSGAL 126 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 97 LNGEWDAPCSGAL 109 >SB_47936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 67 LNGEWDAPCSGAL 79 >SB_47873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_47842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 15 LNGEWDAPCSGAL 27 >SB_47650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 123 LNGEWDAPCSGAL 135 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 143 LNGEWDAPCSGAL 155 >SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 55 LNGEWDAPCSGAL 67 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 87 LNGEWDAPCSGAL 99 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 96 LNGEWDAPCSGAL 108 >SB_47060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_46943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_46899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 710 LNGEWDAPCSGAL 722 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 95 LNGEWDAPCSGAL 107 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 84 LNGEWDAPCSGAL 96 >SB_46559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 26 LNGEWDAPCSGAL 38 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 85 LNGEWDAPCSGAL 97 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 76 LNGEWDAPCSGAL 88 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = -2 Query: 599 CAXTGRVPFAI----HTGNSYDHDPLESTCRHA 513 C TGR+ F I H + DPLESTCRHA Sbjct: 23 CLTTGRLQFRIDQCLHQVCALFGDPLESTCRHA 55 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 83 LNGEWDAPCSGAL 95 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 90 LNGEWDAPCSGAL 102 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 564 VNGEWDAPCXGAL 602 +NGEWDAPC GAL Sbjct: 89 LNGEWDAPCSGAL 101 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,674,733 Number of Sequences: 59808 Number of extensions: 489472 Number of successful extensions: 5086 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5085 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -