BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A15 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25H2.08c |mrs2||magnesium ion transporter Mrs2|Schizosacchar... 26 4.4 SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharo... 26 5.8 >SPBC25H2.08c |mrs2||magnesium ion transporter Mrs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 422 Score = 26.2 bits (55), Expect = 4.4 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -3 Query: 521 KSQLKQVFRSSDFK----TFASLSL*LLGTVKKIKAAFHILHCFISNIKQGRDVNINQ 360 + +LKQ +SSDF +L L+ V + + H+LH +S++ +++INQ Sbjct: 173 EGRLKQ--KSSDFGWLPYEMRALETILVSVVNTLDSELHVLHNLVSDLLADFELDINQ 228 >SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 25.8 bits (54), Expect = 5.8 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 297 LSTYTIEYINKITIVKGMSYLLIDIYIT 380 L TY EY ++ V+GMS LL IY+T Sbjct: 517 LLTYN-EYDTELGYVQGMSDLLAPIYVT 543 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,492,840 Number of Sequences: 5004 Number of extensions: 47754 Number of successful extensions: 97 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -