BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A15 (682 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125457-1|AAD12831.1| 108|Caenorhabditis elegans Hypothetical ... 29 3.1 Z75554-7|CAA99960.1| 297|Caenorhabditis elegans Hypothetical pr... 27 9.4 >AF125457-1|AAD12831.1| 108|Caenorhabditis elegans Hypothetical protein Y50F7A.2 protein. Length = 108 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -3 Query: 224 FKQMFSYFNRIFN-MGQQVIVLFQNTATFNKKFEKYPRY 111 F+ +F YF ++ N + + ++ +N F +K EKYP+Y Sbjct: 71 FQNIFPYFLKLLNYVSENATLMLEN---FFEKLEKYPKY 106 >Z75554-7|CAA99960.1| 297|Caenorhabditis elegans Hypothetical protein ZC455.9 protein. Length = 297 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 501 FQIIRF*NVCISIVVIIRYSKKNKSSFSHFALFH 400 +QI F ++C SI V I Y + S S F LFH Sbjct: 48 YQIRFFVDICYSIAVSIYYVALDISYLSPFFLFH 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,794,082 Number of Sequences: 27780 Number of extensions: 270671 Number of successful extensions: 621 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -