BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A13 (611 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 39 1e-04 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 4.4 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 5.9 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 5.9 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 5.9 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 38.7 bits (86), Expect = 1e-04 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -1 Query: 611 SMPTFVFVKNGKKLDEFSGANVDKLXTTILKH 516 SMPTF+F+K + + +FSGAN +KL I +H Sbjct: 74 SMPTFLFIKRKEVVGQFSGANAEKLENFIQQH 105 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 125 FKNFCK*QVSXCFFFLCYASRS 60 F+ FC +V+ FF CYA S Sbjct: 69 FEGFCIAEVNGVFFCSCYAPPS 90 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 5.9 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 164 GEIIHLSNSDKNKKKTTIHTLKFLSTPLINKKPN 265 GE++ + S K T ++ L F S P + PN Sbjct: 126 GELLAVMGSSGAGKTTLLNALAFRSPPGVKISPN 159 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 5.9 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 164 GEIIHLSNSDKNKKKTTIHTLKFLSTPLINKKPN 265 GE++ + S K T ++ L F S P + PN Sbjct: 126 GELLAVMGSSGAGKTTLLNALAFRSPPGVKISPN 159 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.4 bits (48), Expect = 5.9 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 164 GEIIHLSNSDKNKKKTTIHTLKFLSTPLINKKPN 265 GE++ + S K T ++ L F S P + PN Sbjct: 104 GELLAVMGSSGAGKTTLLNALAFRSPPGVKISPN 137 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,441 Number of Sequences: 2352 Number of extensions: 10912 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -