BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A09 (779 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 26 1.1 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 26 1.5 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 26.2 bits (55), Expect = 1.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 342 RSFSLIHTSDCLTSRNCR 395 RSFSL+ + CL R CR Sbjct: 22 RSFSLLSSDPCLEKRTCR 39 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 653 CLYFNYLISLL--CDCRDCECNLY*EK*VNIWH*ENWNTN 540 C Y + +L CD C+C + K +H ++W++N Sbjct: 734 CKYDTHCFALCHCCDFYACDCKMECPKQCTCYHDQSWSSN 773 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,688 Number of Sequences: 2352 Number of extensions: 14583 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -