BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A07 (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 27 0.83 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 27 0.83 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 27 0.83 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 27 0.83 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 27 0.83 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 27 0.83 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 27 0.83 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 27 0.83 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 27 0.83 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 26 1.1 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 26 1.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 26 1.5 AY331408-1|AAQ97589.1| 100|Anopheles gambiae agCP14332 protein. 25 2.5 AY331407-1|AAQ97588.1| 101|Anopheles gambiae agCP14332 protein. 25 2.5 AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. 25 2.5 AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. 25 2.5 AY331404-1|AAQ97585.1| 100|Anopheles gambiae agCP14332 protein. 25 2.5 AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. 25 2.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 4.5 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 4.5 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 4.5 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 24 5.9 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 7.8 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 26.6 bits (56), Expect = 0.83 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 271 RRCRPTDTRANPPLARATCDQQCNQNCAFGEVKTV 167 R CR T R N +R TC + C Q C + E++ V Sbjct: 150 RNCR-TAARRNHS-SRNTCRRNCYQQCIYEELEAV 182 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 26.6 bits (56), Expect = 0.83 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 216 HVA-LASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLS 392 HV+ A +A +V H P++ + P+ A + P H A A Sbjct: 162 HVSSYAHAPVAHATVQHHHAAPIAHYSAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSI 219 Query: 393 VRGPSHAVH 419 V GPSH H Sbjct: 220 VHGPSHLSH 228 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 26.6 bits (56), Expect = 0.83 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 216 HVA-LASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLS 392 HV+ A +A +V H P++ + P+ A + P H A A Sbjct: 162 HVSSYAHAPVAHATVQHHHAAPIAHYAAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSI 219 Query: 393 VRGPSHAVH 419 V GPSH H Sbjct: 220 VHGPSHLSH 228 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 26.6 bits (56), Expect = 0.83 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 216 HVA-LASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLS 392 HV+ A +A +V H P++ + P+ A + P H A A Sbjct: 170 HVSSYAHAPVAHATVQHHHAAPIAHYSAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSI 227 Query: 393 VRGPSHAVH 419 V GPSH H Sbjct: 228 VHGPSHLSH 236 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 26.6 bits (56), Expect = 0.83 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 216 HVA-LASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLS 392 HV+ A +A +V H P++ + P+ A + P H A A Sbjct: 162 HVSSYAHAPVAHATVQHHHAAPIAHYAAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSI 219 Query: 393 VRGPSHAVH 419 V GPSH H Sbjct: 220 VHGPSHLSH 228 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 26.6 bits (56), Expect = 0.83 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 216 HVA-LASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLS 392 HV+ A +A +V H P++ + P+ A + P H A A Sbjct: 170 HVSSYAHAPVAHATVQHHHAAPIAHYSAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSI 227 Query: 393 VRGPSHAVH 419 V GPSH H Sbjct: 228 VHGPSHLSH 236 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 26.6 bits (56), Expect = 0.83 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 216 HVA-LASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLS 392 HV+ A +A +V H P++ + P+ A + P H A A Sbjct: 194 HVSSYAHAPVAHATVQHHHAAPIAHYSAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSI 251 Query: 393 VRGPSHAVH 419 V GPSH H Sbjct: 252 VHGPSHLSH 260 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 26.6 bits (56), Expect = 0.83 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 216 HVA-LASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLS 392 HV+ A +A +V H P++ + P+ A + P H A A Sbjct: 162 HVSSYAHAPVAHATVQHHHAAPIAHYAAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSI 219 Query: 393 VRGPSHAVH 419 V GPSH H Sbjct: 220 VHGPSHLSH 228 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 26.6 bits (56), Expect = 0.83 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = +3 Query: 216 HVA-LASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLS 392 HV+ A +A +V H P++ + P+ A + P H A A Sbjct: 162 HVSSYAHAPVAHATVQHHHAAPIAHYSAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSI 219 Query: 393 VRGPSHAVH 419 V GPSH H Sbjct: 220 VHGPSHLSH 228 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 26.2 bits (55), Expect = 1.1 Identities = 17/64 (26%), Positives = 24/64 (37%) Frame = +3 Query: 228 ASGGLARVSVGRHLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLSVRGPS 407 A +A +V H P++ + P+ A + P H A A V GPS Sbjct: 175 AHAPVAHATVQHHHAAPIAHYSAPIAHHAAPI--AHYAAPIAHHAAPIAHSTSSIVHGPS 232 Query: 408 HAVH 419 H H Sbjct: 233 HLSH 236 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -3 Query: 437 RGHFGPVHCVRWSPDGELYASGSEDGTVRLWQAVPGR 327 RGH V V+W+ + AS G + +W GR Sbjct: 61 RGHRSDVILVKWNEPYQKLASCDSSGIIFVWIKYEGR 97 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/52 (28%), Positives = 19/52 (36%) Frame = +3 Query: 264 HLLVPVSEGRGLVGAAPQPVGAARHRLPQPHRAVLRAGRVQLSVRGPSHAVH 419 H P++ + P+ A H P H A A V GPSH H Sbjct: 182 HYSAPIAHHAAPIAHYAAPI--AHHAAPIAHHAAPIAHSTSSIVHGPSHLSH 231 >AY331408-1|AAQ97589.1| 100|Anopheles gambiae agCP14332 protein. Length = 100 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 592 RRTRCASYASSPCQRSAT 539 RRTRC S SP R+ T Sbjct: 57 RRTRCGSLCGSPVSRAQT 74 >AY331407-1|AAQ97588.1| 101|Anopheles gambiae agCP14332 protein. Length = 101 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 592 RRTRCASYASSPCQRSAT 539 RRTRC S SP R+ T Sbjct: 57 RRTRCGSLCGSPVSRAQT 74 >AY331406-1|AAQ97587.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 592 RRTRCASYASSPCQRSAT 539 RRTRC S SP R+ T Sbjct: 57 RRTRCGSLCGSPVSRAQT 74 >AY331405-1|AAQ97586.1| 96|Anopheles gambiae agCP14332 protein. Length = 96 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 592 RRTRCASYASSPCQRSAT 539 RRTRC S SP R+ T Sbjct: 57 RRTRCGSLCGSPVSRAQT 74 >AY331404-1|AAQ97585.1| 100|Anopheles gambiae agCP14332 protein. Length = 100 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 592 RRTRCASYASSPCQRSAT 539 RRTRC S SP R+ T Sbjct: 57 RRTRCGSLCGSPVSRAQT 74 >AY331403-1|AAQ97584.1| 103|Anopheles gambiae agCP14332 protein. Length = 103 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 592 RRTRCASYASSPCQRSAT 539 RRTRC S SP R+ T Sbjct: 58 RRTRCGSLCGSPVSRAQT 75 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 4.5 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -1 Query: 229 ARATCDQQCNQNCAFGEVKTVCC 161 ++ C QC+Q FG CC Sbjct: 180 SKLNCSPQCSQGRCFGPKPRECC 202 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 330 ARHRLPQPHRAVLRAGRVQLSVRGPSHAVH 419 A H P H A A V GPSH H Sbjct: 200 AHHAAPIAHHAAPIAHSTSSIVHGPSHLSH 229 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 330 ARHRLPQPHRAVLRAGRVQLSVRGPSHAVH 419 A H P H A A V GPSH H Sbjct: 200 AHHAAPIAHHAAPIAHSTSSIVHGPSHLSH 229 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 3/21 (14%) Frame = -1 Query: 613 VQTYRFIR---RTRCASYASS 560 ++TY F+R + RCASY SS Sbjct: 936 LKTYDFVRDRHKIRCASYVSS 956 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.4 bits (48), Expect = 7.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 506 VCGGDDLKVYKYDYNTGTELESNRGHFGPVHC 411 V GG K+ ++ + E E G FG HC Sbjct: 108 VLGGQPTKIDEFPWTALIEYEKPNGRFG-FHC 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,739 Number of Sequences: 2352 Number of extensions: 17652 Number of successful extensions: 50 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -