BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_pT_A01 (457 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|S... 50 2e-07 SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosa... 50 2e-07 SPAC22A12.13 |mug84||pig-P |Schizosaccharomyces pombe|chr 1|||Ma... 27 1.4 SPAC1952.03 |||cysteine protease, OTU family|Schizosaccharomyces... 25 4.2 >SPBC19G7.03c |rps3002|rps30-2, rps30|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 2|||Manual Length = 61 Score = 50.0 bits (114), Expect = 2e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -2 Query: 198 GKVHGSLARAGKVKGQTPKVEXXXXXXXKTGRAKRRI 88 GKVHGSLARAGKVK QTPKVE GRA +R+ Sbjct: 2 GKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRAYKRL 38 >SPAC19B12.04 |rps3001|rps30-1|40S ribosomal protein S30|Schizosaccharomyces pombe|chr 1|||Manual Length = 61 Score = 50.0 bits (114), Expect = 2e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = -2 Query: 198 GKVHGSLARAGKVKGQTPKVEXXXXXXXKTGRAKRRI 88 GKVHGSLARAGKVK QTPKVE GRA +R+ Sbjct: 2 GKVHGSLARAGKVKSQTPKVEKQEKPKQPKGRAYKRL 38 >SPAC22A12.13 |mug84||pig-P |Schizosaccharomyces pombe|chr 1|||Manual Length = 120 Score = 27.1 bits (57), Expect = 1.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 81 VLEFYA*HGQSSSSFFVVFPLWGFVL*LYLH 173 VL+F+ H S + + P W FVL +Y+H Sbjct: 35 VLKFFEIHYYLSRWWALAIPTWLFVLVIYIH 65 >SPAC1952.03 |||cysteine protease, OTU family|Schizosaccharomyces pombe|chr 1|||Manual Length = 324 Score = 25.4 bits (53), Expect = 4.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 108 GRAKRRIQVQQKICQRCADLRTSSRTQLQFID 13 G K++ +QQKI Q ADL T+ Q +D Sbjct: 53 GNKKQKRALQQKISQMEADLSQKHATERQKLD 84 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,637,961 Number of Sequences: 5004 Number of extensions: 26964 Number of successful extensions: 58 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 170285640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -