BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P23 (527 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17270.1 68418.m02023 tetratricopeptide repeat (TPR)-containi... 27 7.8 At4g28570.1 68417.m04087 alcohol oxidase-related low similarity ... 27 7.8 >At5g17270.1 68418.m02023 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 899 Score = 27.1 bits (57), Expect = 7.8 Identities = 9/33 (27%), Positives = 22/33 (66%) Frame = +3 Query: 57 TLNTTCWKCSLELDDDELINIEQWINSRAYKKG 155 T+N +C++ +LE+ +D+ + ++ + AY +G Sbjct: 556 TINDSCYEKALEVSNDKSVRAKRALARSAYNRG 588 >At4g28570.1 68417.m04087 alcohol oxidase-related low similarity to long chain fatty alcohol oxidase from Candida cloacae [GI:6983581], Candida tropicalis [GI:6983594] Length = 748 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 405 YIVRRSQI-LDKLRALLKNWSILPTILRSIVITF 503 ++++ SQ+ LDK A+L+NWS L ITF Sbjct: 115 FVLKFSQLPLDKREAILRNWSRQSGFLLPFRITF 148 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,002,341 Number of Sequences: 28952 Number of extensions: 187833 Number of successful extensions: 423 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -