BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P20 (545 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 264 5e-73 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 6.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.2 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 6.2 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 6.2 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 6.2 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 264 bits (646), Expect = 5e-73 Identities = 124/134 (92%), Positives = 129/134 (96%) Frame = +2 Query: 71 MAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYG 250 MAIRPVYRPTIVKKRTK+FIRHQSDRY KLKRNWRKP+GIDNRVRRRFKGQYLMPNIGYG Sbjct: 1 MAIRPVYRPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYG 60 Query: 251 SNKKTRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIR 430 SNKKTRHMLP GFRKVLVHNVKELE+LMMQNRK+CAEIAHG SSKKRK IVERAQQLSIR Sbjct: 61 SNKKTRHMLPTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIR 120 Query: 431 VTNAAARLRSQENE 472 VT A+ARLRSQENE Sbjct: 121 VTYASARLRSQENE 134 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 1.5 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = +2 Query: 227 LMPNIGYGSNKKTRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVE 406 L + G + + +P+G+ + + EL L + + + + HG+ R LIV+ Sbjct: 66 LAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLI---RDLIVD 122 Query: 407 R 409 R Sbjct: 123 R 123 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 340 KQEVLRRDRSWCLFEEAEAD 399 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 340 KQEVLRRDRSWCLFEEAEAD 399 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 340 KQEVLRRDRSWCLFEEAEAD 399 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 340 KQEVLRRDRSWCLFEEAEAD 399 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 340 KQEVLRRDRSWCLFEEAEAD 399 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 340 KQEVLRRDRSWCLFEEAEAD 399 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 340 KQEVLRRDRSWCLFEEAEAD 399 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 340 KQEVLRRDRSWCLFEEAEAD 399 ++E LRR R W + +E E + Sbjct: 32 QEERLRRRREWMIQQERERE 51 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 493 LIIQLYLFILLGAEASGRI 437 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 493 LIIQLYLFILLGAEASGRI 437 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 493 LIIQLYLFILLGAEASGRI 437 L + +LF++ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,704 Number of Sequences: 438 Number of extensions: 2716 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -