BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P17 (761 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 28 0.082 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 1.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.3 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 1.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 4.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 4.1 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 4.1 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 4.1 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 4.1 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 4.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 4.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 4.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.4 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 22 7.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 7.1 S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 21 9.4 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 28.3 bits (60), Expect = 0.082 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 495 SLPRPGSRPLGGTPTPVTNTSLKANPQPSRN 587 S PR GS P TPTP T L Q RN Sbjct: 149 SFPRGGSLPTPVTPTPTTVQQLLRRAQIRRN 179 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R A + +ER+R+ Sbjct: 21 EDNEIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R A + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R A + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREAWLIQQERERE 52 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQF 108 +DN + L RT + R + R A + +ER++++ Sbjct: 21 EDNKIDLRSRTKEERLQYRREAWLVQQEREQEY 53 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 3.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 513 SRPLGGTPTPVTNTSLKANPQPSRNFGSGH 602 +R G T ++ N PSR GSGH Sbjct: 1902 ARGKDGMTTEEMRKLIERNEAPSRQTGSGH 1931 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 10 DDNSLLLHDRTTDARARCRITALNLSRERDRQ 105 +DN + L RT + R + R + +ER+R+ Sbjct: 21 EDNKIDLRSRTKEERLQHRREVWLIQQERERE 52 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 24 ASPRSNDRRPRPVSYYSSKFIS*ARSP 104 ASPRS + P P +S ARSP Sbjct: 736 ASPRSPNASPSPAEQCASTTTITARSP 762 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 646 PSRVS*TNNTTLLSIYTATRQLRRPCRPKP 735 P +S + ++ + S+Y + Q PC P P Sbjct: 369 PPTLSESYSSYVNSMYASGAQFATPCTPSP 398 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 697 LYILTGVLYCLFTTL 653 LYIL+G LY TT+ Sbjct: 309 LYILSGCLYYFSTTI 323 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 501 PRPGSRPLGGTPTP 542 P PG +G TPTP Sbjct: 115 PSPGMGHMGHTPTP 128 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 425 SSADGVLRVLVTQGEHVCVV 366 SSA+G + + T G H+ +V Sbjct: 41 SSAEGWFKAIGTCGSHIIIV 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,199 Number of Sequences: 438 Number of extensions: 4960 Number of successful extensions: 19 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -