BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P16 (828 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1273| Best HMM Match : polyprenyl_synt (HMM E-Value=3.64338e-44) 131 6e-31 SB_47534| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) 29 6.1 SB_32154| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_54549| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_1273| Best HMM Match : polyprenyl_synt (HMM E-Value=3.64338e-44) Length = 303 Score = 131 bits (317), Expect = 6e-31 Identities = 64/151 (42%), Positives = 93/151 (61%), Gaps = 3/151 (1%) Frame = +2 Query: 353 KMFDDLLPEVIMTLQNKSKLSEVPQIGD---WLKKMLHYNLVGGKHTRGITTVISYKTIE 523 K+FDD P + L + + IGD WL+++L YN+ GGK RG++ + S + + Sbjct: 19 KLFDDAFPGFVNDLVQEEENDLA--IGDSIKWLREVLEYNVPGGKRNRGLSVIGSLRHLI 76 Query: 524 KPEKVTEHTLKMACKLGWCVEMFQAYCIVLDDIMDGSSVRRGMPCWYRRPEVGITCAFND 703 + E T+ L++A LGWCVE FQA+ +V DDIMD S RRG PCWYR+PEVG A ND Sbjct: 77 REEHFTDEHLRVALLLGWCVEWFQAFFLVADDIMDQSMTRRGQPCWYRQPEVG-NIAIND 135 Query: 704 SLLIHSSLFEFLKTNFRTNPNYMKMFELFNE 796 ++I ++F LK + + Y+ + ELF+E Sbjct: 136 GIMIEQTVFRLLKKHIKHQSYYVDVVELFHE 166 >SB_47534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/66 (24%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = -2 Query: 212 CHEVQCAGRTIYVSIFNSSVHVAIHTAEDRQ*WCRIIQEKVISRDHNSQH*GLSTS--RR 39 CH C RT YV++ + V +AI W ++ + +++ N +S + R Sbjct: 416 CHAASCTSRTTYVNVMHFRVCLAISRIHVLTSWLQLFRHSLVAHASNDVMMSISVTCISR 475 Query: 38 KMSILQ 21 ++ LQ Sbjct: 476 SLAALQ 481 >SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) Length = 428 Score = 28.7 bits (61), Expect = 6.1 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 1/98 (1%) Frame = +2 Query: 368 LLPEVIMTLQNKSKLSEVPQIGDWLKKMLHYNLVGGKHTRGITTVISYKTIEK-PEKVTE 544 ++ E +M + + L+E WL+K + +G + G ++ +T+E E+ E Sbjct: 98 MIQEEVMIIAERLGLNEFTGSNGWLEKFKRQHNIGQRAVSGEEAGVNPETVESWKERARE 157 Query: 545 HTLKMACKLGWCVEMFQAYCIVLDDIMDGSSVRRGMPC 658 T K W V+ + C+ + + S RGM C Sbjct: 158 ITRGWDAKNVWNVD--ETGCL-WRGLPEKSLNERGMRC 192 >SB_32154| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/69 (24%), Positives = 31/69 (44%), Gaps = 7/69 (10%) Frame = +2 Query: 203 LHDIVDMSVFNCLKFTRKVTYKYWPQLIRYKNNSANMTTASKNL-------EIINEKKMF 361 +H +D +F C+ TRK ++ +P++ S + SK I+N F Sbjct: 99 IHSEMDSEMFRCVSSTRKRNFRPYPEIFENALQSGFFLSDSKTYCVDGSIRNILNTLTSF 158 Query: 362 DDLLPEVIM 388 +LPE+ + Sbjct: 159 CWILPEITL 167 >SB_54549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = -2 Query: 227 HSCLLCHEVQCAGRTIYVSIFNSSVHVAI-----HTAEDRQ*WCRIIQEKVISRDHNSQH 63 H ++C V GR ++ S +S + V I T +R+ WC +EK+IS HN H Sbjct: 86 HDNIICAIVY-NGRYVFTSS-HSCIKVCILFCTGFTGGERRGWCDETEEKLISGSHNVIH 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,356,753 Number of Sequences: 59808 Number of extensions: 561738 Number of successful extensions: 1357 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1356 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -