BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P15 (559 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 1.8 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.1 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.2 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 23.0 bits (47), Expect = 1.8 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -2 Query: 453 SGMVDYRSLWVPI*PRILRMDDWSVHTLLVYQLAMYEFLS*VRSLY 316 S + DYRSLW+ + I + + S +T V L +Y FL ++Y Sbjct: 261 SQVADYRSLWMLLSKLIRDVGNASGYT--VTFLCLYLFLIITLTIY 304 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 446 IPEMDWRYCARMRIVIN*LLMCFKNK 523 +PE D Y + R+ + LL+ KNK Sbjct: 268 VPETDEVYTGKRRLAMLDLLLTAKNK 293 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 446 IPEMDWRYCARMRIVIN*LLMCFKNK 523 +PE D Y + R+ + LL+ KNK Sbjct: 268 VPETDEVYTGKRRLAMLDLLLTAKNK 293 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +3 Query: 90 TFYLSIVRP 116 TFYL++VRP Sbjct: 324 TFYLNVVRP 332 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,073 Number of Sequences: 336 Number of extensions: 2930 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -