BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P12 (510 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 4.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.4 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 8.4 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 8.4 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.4 bits (43), Expect = 4.8 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 353 TTSGQRSQRARHRGGLSAGGAAREGVAADP 442 TT ++ + G S G +EG+ DP Sbjct: 423 TTQKPQTTKTPESGNESDGVCTKEGIVRDP 452 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 6.4 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 111 TKETCDIFLV*VPVFIGTV*IFSYLKVYNISK 206 TK+ I L+ VF+ T +F Y V + + Sbjct: 484 TKQQSKIHLIVRSVFVTTYLMFDYCTVLRVQR 515 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 20.6 bits (41), Expect = 8.4 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 405 PAELLARASRQTLALXEGEPCGSRGAXVIIDVAG 506 PA+L + TL +GEP II +G Sbjct: 357 PAQLTIQGHDLTLIATDGEPVHPVRVNTIISFSG 390 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 20.6 bits (41), Expect = 8.4 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 405 PAELLARASRQTLALXEGEPCGSRGAXVIIDVAG 506 PA+L + TL +GEP II +G Sbjct: 357 PAQLTIQGHDLTLIATDGEPVHPVRVNTIISFSG 390 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 8.4 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 291 WREAPAPVPTEAALAQRLE 347 W+E P PT L++ LE Sbjct: 731 WKECPKNRPTFTELSKSLE 749 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,523 Number of Sequences: 336 Number of extensions: 1598 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12154132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -