BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P12 (510 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 24 2.6 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 23 7.9 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 24.2 bits (50), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 377 RARHRGGLSAGGAAREGVAADPRAXGGR 460 R R RGG GG G D GGR Sbjct: 81 RGRGRGGRDGGGGFGGGGYGDRNGDGGR 108 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 22.6 bits (46), Expect = 7.9 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = +3 Query: 309 PVPTEAALAQRLERELRAAKGASELATAEVLVPAELLARASRQTL 443 P P + AL Q ++ A G L+ L+P + +R L Sbjct: 514 PTPGQDALLQNVQWPTVGATGTGYLSIGHDLLPVQQTPNPTRMNL 558 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 407,938 Number of Sequences: 2352 Number of extensions: 5817 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -