BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P12 (510 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) cont... 28 3.2 At2g36970.1 68415.m04534 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.3 At4g32330.2 68417.m04600 expressed protein 27 9.7 At4g32330.1 68417.m04599 expressed protein 27 9.7 At3g14350.3 68416.m01816 leucine-rich repeat transmembrane prote... 27 9.7 At3g14350.2 68416.m01814 leucine-rich repeat transmembrane prote... 27 9.7 At3g14350.1 68416.m01815 leucine-rich repeat transmembrane prote... 27 9.7 >At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) contains similarity to 40S ribosomal protein S10 Length = 179 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 Query: 362 GQRSQRARHRGGLSAGGAAREGVAADPRAXG 454 G RS+ RH GG R+G A PRA G Sbjct: 107 GDRSRGPRHEGGDRPRFGDRDGYRAGPRAGG 137 >At2g36970.1 68415.m04534 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 27.1 bits (57), Expect = 7.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 114 LYC*FALNDRFSDRRLVIVKRSMGI*KCPKLTTASD 7 L C L D+F++R+LV+ +GI C K T D Sbjct: 385 LLCYPLLTDQFTNRKLVVDDWCIGINLCEKKTITRD 420 >At4g32330.2 68417.m04600 expressed protein Length = 436 Score = 26.6 bits (56), Expect = 9.7 Identities = 19/87 (21%), Positives = 33/87 (37%) Frame = +3 Query: 228 LPVTNQFNVGFNSEKAWSGPTWREAPAPVPTEAALAQRLERELRAAKGASELATAEVLVP 407 +P T + +K SG E P +L +R ++ AKG + Sbjct: 281 IPPTRPKSPKLGRKKTASGADSEETQTPRLGRLSLDERASKDNPTAKGIMPTVDLKKQPV 340 Query: 408 AELLARASRQTLALXEGEPCGSRGAXV 488 + L R Q L +G+P ++ A + Sbjct: 341 RKSLPRLPSQKTVLPDGKPAPAKAAII 367 >At4g32330.1 68417.m04599 expressed protein Length = 437 Score = 26.6 bits (56), Expect = 9.7 Identities = 19/87 (21%), Positives = 33/87 (37%) Frame = +3 Query: 228 LPVTNQFNVGFNSEKAWSGPTWREAPAPVPTEAALAQRLERELRAAKGASELATAEVLVP 407 +P T + +K SG E P +L +R ++ AKG + Sbjct: 282 IPPTRPKSPKLGRKKTASGADSEETQTPRLGRLSLDERASKDNPTAKGIMPTVDLKKQPV 341 Query: 408 AELLARASRQTLALXEGEPCGSRGAXV 488 + L R Q L +G+P ++ A + Sbjct: 342 RKSLPRLPSQKTVLPDGKPAPAKAAII 368 >At3g14350.3 68416.m01816 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 689 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 37 SYSHRSLDDN*SPVRKPVVQCELAV 111 S H+S DD+ S +RKP+V + AV Sbjct: 374 SERHKSFDDDDSTMRKPIVAKKAAV 398 >At3g14350.2 68416.m01814 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 680 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 37 SYSHRSLDDN*SPVRKPVVQCELAV 111 S H+S DD+ S +RKP+V + AV Sbjct: 337 SERHKSFDDDDSTMRKPIVAKKAAV 361 >At3g14350.1 68416.m01815 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 717 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 37 SYSHRSLDDN*SPVRKPVVQCELAV 111 S H+S DD+ S +RKP+V + AV Sbjct: 374 SERHKSFDDDDSTMRKPIVAKKAAV 398 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,356,936 Number of Sequences: 28952 Number of extensions: 140768 Number of successful extensions: 368 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -