BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_P05 (504 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0585 + 20824752-20825954,20826141-20826329,20826533-208266... 33 0.17 12_02_0616 - 21246374-21246462,21246605-21247702,21247800-212481... 29 2.8 01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177,804... 28 4.9 06_03_0267 + 18970578-18972464 27 6.5 >12_02_0585 + 20824752-20825954,20826141-20826329,20826533-20826690, 20826913-20827009,20827368-20827730,20829225-20829303, 20830180-20830286 Length = 731 Score = 32.7 bits (71), Expect = 0.17 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 46 NREKAFLFVKNCGGDWIPTSFSAGKEFCCTNGEHHKC 156 N +A+L + +CGG W P +++ GK T E C Sbjct: 623 NNMEAYLCIPSCGGRWTPCAWNGGKFGSATKYEWKPC 659 >12_02_0616 - 21246374-21246462,21246605-21247702,21247800-21248110, 21248550-21249251,21252802-21252912,21253396-21253481, 21253753-21253862,21254085-21254236,21254656-21254765 Length = 922 Score = 28.7 bits (61), Expect = 2.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 91 WIPTSFSAGKEFCCTNGEHHKC*YNHKKIG 180 W+ S G CC + H +C H+K+G Sbjct: 368 WLVCSSETGDRDCCESSCHIECALQHQKVG 397 >01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177, 8048455-8048540,8048698-8048983,8049063-8049205, 8049308-8049508,8049626-8049754,8050463-8050738, 8050823-8051098,8051364-8052364,8052452-8052634, 8052865-8052937,8053205-8053313,8053622-8053785 Length = 1093 Score = 27.9 bits (59), Expect = 4.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 30 CRTRCQ*GKGLLVCEKLWRRLDSH*LFC 113 C TR + G G +C +W+ L +H L C Sbjct: 1037 CHTRARGGGGCHMCVFMWKLLFTHSLLC 1064 >06_03_0267 + 18970578-18972464 Length = 628 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 73 KNCGGDWIPTSFSAGKEFCCTNGEHHKC 156 K C + P S G EFC +G +C Sbjct: 422 KRCSAEGCPKSVHGGTEFCVAHGGGKRC 449 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,146,925 Number of Sequences: 37544 Number of extensions: 175434 Number of successful extensions: 340 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -