BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O24 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 2.4 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 4.2 AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucl... 24 5.6 AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deo... 24 5.6 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.8 AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 prote... 23 9.8 AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 prote... 23 9.8 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 9.8 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 224 QLSSEALEAGRICCNKYLVKNCGKDQFHIRMRLH 325 +L+ E L G CN + K CGK HIR H Sbjct: 487 RLTFERLSGG---CNLHRCKLCGKVVTHIRNHYH 517 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 24.2 bits (50), Expect = 4.2 Identities = 22/77 (28%), Positives = 36/77 (46%) Frame = +3 Query: 450 PSCPCALVTGGRHRSSRLCAVPSSSSPDVKRSTYQRSGVSQSMNVMSLRSCVKRAASPMT 629 P+ P + + G + L V +P+ K S +S + +S+NV+S+ AA M Sbjct: 685 PASPASSIKSGYGEGAPLAIV----APE-KNSV--KSAIVKSINVVSI------AAKTMR 731 Query: 630 AASCSTARNMDLSTLGG 680 CS+ D S +GG Sbjct: 732 EGRCSSVSGGDWSPMGG 748 >AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucleoside kinase protein. Length = 245 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/52 (19%), Positives = 25/52 (48%) Frame = +3 Query: 573 SMNVMSLRSCVKRAASPMTAASCSTARNMDLSTLGGRFRLRSSMYNLINTFY 728 ++ ++ + +C + + S +ARN + ++ L MYN++ +Y Sbjct: 80 TLTMLDMHTCQTDKSVKLMERSLFSARNCFVESMLASGSLHQGMYNVLQEWY 131 >AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deoxyribonucleoside kinaseprotein. Length = 246 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/52 (19%), Positives = 25/52 (48%) Frame = +3 Query: 573 SMNVMSLRSCVKRAASPMTAASCSTARNMDLSTLGGRFRLRSSMYNLINTFY 728 ++ ++ + +C + + S +ARN + ++ L MYN++ +Y Sbjct: 80 TLTMLDMHTCQTDKSVKLMERSLFSARNCFVESMLASGSLHQGMYNVLQEWY 131 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 219 YSSDTKCTHSGKSSTF 172 Y+S TK TH+ KS T+ Sbjct: 474 YNSKTKSTHTPKSITY 489 >AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -2 Query: 550 YVDLLTSGELELGT 509 YV+LL +G+L++GT Sbjct: 136 YVELLRAGKLDMGT 149 >AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -2 Query: 550 YVDLLTSGELELGT 509 YV+LL +G+L++GT Sbjct: 136 YVELLRAGKLDMGT 149 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 695 SQPEPSSKRREVHVPGGTARCS 630 S P PS K EV P RC+ Sbjct: 117 SSPVPSMKELEVAFPRNLCRCT 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 869,882 Number of Sequences: 2352 Number of extensions: 19506 Number of successful extensions: 45 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -