BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O23 (540 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0639 + 30772804-30772904,30773386-30775675 27 7.2 07_03_0631 + 20104332-20106802,20106904-20107030,20107352-201074... 27 9.6 >01_06_0639 + 30772804-30772904,30773386-30775675 Length = 796 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +3 Query: 153 RQDNDNIGVEGYNTGYETSNGIKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTY 320 R+ +N GV GY TG+ +G +G N +A + R ++ Y GP G +Y Sbjct: 221 RRQGNNSGVSGYGTGHH-YHGSDTYRSGY--NTQNNQQAYDSR-QYGY-GPSGQSY 271 >07_03_0631 + 20104332-20106802,20106904-20107030,20107352-20107479, 20108771-20109083 Length = 1012 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = -2 Query: 347 TLVSDVGHSVSNSVRADVRKFSADLKSFVFSANVLQLTGFLSLDSVGGFIAG 192 T S+V H++ + + K + S + + LT SL+S+G IAG Sbjct: 293 TTRSEVTHAIPGGIVITLDKIPTSVLSMILKHHAFGLTRKDSLESIGDKIAG 344 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,671,113 Number of Sequences: 37544 Number of extensions: 184124 Number of successful extensions: 426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1198356516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -