BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O11 (809 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 128 6e-32 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 4.4 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 4.4 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 4.4 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 4.4 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 4.4 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 4.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 4.4 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 4.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 4.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 4.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 4.4 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 4.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 5.8 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 5.8 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 5.8 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 5.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 5.8 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 5.8 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 5.8 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 5.8 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 5.8 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 5.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.8 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 5.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 5.8 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 5.8 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 5.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.8 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 5.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 5.8 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.8 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 5.8 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 5.8 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 22 7.7 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 128 bits (309), Expect = 6e-32 Identities = 77/210 (36%), Positives = 121/210 (57%), Gaps = 7/210 (3%) Frame = +3 Query: 201 AFQSMGLSFPVLKGITKRGYKQPTPIQRKTIPIALTGKDVVAMARTGSGKTACFVLPILE 380 +F++ GL VL I K GYK+PTP+Q+ +PI + G+D++A A+TGSGKTA F +PI+ Sbjct: 197 SFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMACAQTGSGKTAAFAVPIIN 256 Query: 381 KLL---VPNNKPTPGKNLRALILSPTRELALQTLRFVRELGKFTGLTSAAILGGESIEQQ 551 LL V + + +I+SPTREL +Q + + + + L + GG S+ Q Sbjct: 257 TLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLNSILKTVVAYGGTSVMHQ 316 Query: 552 FNVMSGSSPDIVVATPGRFLHICIEMCLKLDNIKIVVFDEADRLFELGFGEQLQEIC--- 722 +S I+VATPGR L + +K +++ +V DEADR+ ++GF ++++ Sbjct: 317 RGKLSAGC-HILVATPGRLLDFVEKGRVKFSSVQFLVLDEADRMLDMGFLPSIEKMVDHE 375 Query: 723 ARLP-SSRQTLLFSATLPKMLVXFARAGLS 809 +P RQTL+FSAT P + AR L+ Sbjct: 376 TMVPLGERQTLMFSATFPDEVQHLARRFLN 405 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 72 NHAAYSNNISTNTRNTQY 19 N+ Y+NN +TN + QY Sbjct: 93 NYNNYNNNYNTNYKKLQY 110 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 72 NHAAYSNNISTNTRNTQY 19 N+ Y+NN +TN + QY Sbjct: 93 NYNNYNNNYNTNYKKLQY 110 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 72 NHAAYSNNISTNTRNTQY 19 N+ Y+NN +TN + QY Sbjct: 93 NYNNYNNNYNTNYKKLQY 110 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 72 NHAAYSNNISTNTRNTQY 19 N+ Y+NN +TN + QY Sbjct: 93 NYNNYNNNYNTNYKKLQY 110 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 72 NHAAYSNNISTNTRNTQY 19 N+ Y+NN +TN + QY Sbjct: 93 NYNNYNNNYNTNYKKLQY 110 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 72 NHAAYSNNISTNTRNTQY 19 N+ Y+NN +TN + QY Sbjct: 93 NYNNYNNNYNTNYKKLQY 110 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 72 NHAAYSNNISTNTRNTQY 19 N+ Y+NN +TN + QY Sbjct: 97 NYNNYNNNYNTNYKKLQY 114 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 72 NHAAYSNNISTNTRNTQY 19 N+ Y+NN +TN + QY Sbjct: 93 NYNNYNNNYNTNYKKLQY 110 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 147 EDVIVIRRTGEGSKPLFEREEIKNVLTKINK 177 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVIVIRRTGEGSKPLFEREEIKNVLTKINK 188 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVIVIRRTGEGSKPLFEREEIKNVLTKINK 188 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 147 EDVIVIRRTGEGSKPLFEREEIKNVLTKINK 177 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 147 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPLFEREEIKNVLTKINK 188 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 147 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 147 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVIPIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 147 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 163 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 193 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 312 KDVVAMARTGSGKTACFVLPILEKLLVPNNK 404 +DV+ + RTG G F ++ +L NK Sbjct: 158 EDVILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.8 bits (44), Expect = 7.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +3 Query: 348 KTACFVLPIL 377 KT CFV+PI+ Sbjct: 225 KTVCFVIPIM 234 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,277 Number of Sequences: 438 Number of extensions: 3798 Number of successful extensions: 41 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -