BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O10 (817 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 24 1.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.4 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 4.5 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 22 7.8 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 7.8 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 660 SSKRCLCEPVYLLVSVNRSTAAAAAGDFVTCDVIP 556 SS L +Y+L+++ R +A +F TC P Sbjct: 90 SSPTILISYIYILMAILRMSADGGCRNFSTCSSHP 124 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 515 LDEIKKKLTTCGQPGITSHVTKS 583 +D I KLT QPG+T+ + S Sbjct: 641 MDAICTKLTADCQPGVTAFIVTS 663 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 663 VSSKRCLCEPVYLLVSVNRSTAAA 592 V ++RCLCE +Y + ++ AA Sbjct: 321 VVARRCLCEYLYKQLELHTEDRAA 344 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 633 VYLLVSVNRSTAAAAAGDFVTCDVIP 556 +Y+L+++ R +A +F TC P Sbjct: 98 IYILMAILRMSADGGCRNFSTCSSHP 123 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 140 RKMSTEAQNTDAAVEQ-VTQEVKDVKLENGNAP 235 RK+ E + TD + Q + ++V D +L NG P Sbjct: 382 RKLDEEMKRTDELLYQMIPKQVAD-RLRNGENP 413 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,505 Number of Sequences: 438 Number of extensions: 4507 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -