BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O08 (484 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 2.6 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 2.6 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 3.4 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 21 6.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 6.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 6.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 6.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 6.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 6.0 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 6.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 6.0 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 7.9 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 7.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 2.6 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 155 TATKVTWTSTVARK-FAAKNTNHATISRECTGLSAPMSGSTSGTTSAPKA 301 T T WT+T R+ + T +T +R T + T GTT P A Sbjct: 1046 TTTSPWWTTTTTRRTTTTRPTTTSTTTRPTT-----TNWPTQGTTIPPPA 1090 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 71 ICLR*SNRPPTSKQHLSTH 127 IC + RP T K HL TH Sbjct: 254 ICGKSYARPSTLKTHLRTH 272 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 3.4 Identities = 16/65 (24%), Positives = 24/65 (36%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP S LST + + T ST A +T +S + S+ S Sbjct: 122 PPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASSTSSTSSTEK 181 Query: 275 SGTTS 289 +GT + Sbjct: 182 AGTNN 186 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 92 RPPTSKQHLSTH 127 RP T K HL TH Sbjct: 5 RPSTLKTHLRTH 16 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 6.0 Identities = 16/65 (24%), Positives = 24/65 (36%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP S LST + + T ST A +T +S + S+ S Sbjct: 122 PPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEK 181 Query: 275 SGTTS 289 +GT + Sbjct: 182 AGTNN 186 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 6.0 Identities = 16/65 (24%), Positives = 24/65 (36%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP S LST + + T ST A +T +S + S+ S Sbjct: 122 PPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEK 181 Query: 275 SGTTS 289 +GT + Sbjct: 182 AGTNN 186 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 6.0 Identities = 16/65 (24%), Positives = 24/65 (36%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP S LST + + T ST A +T +S + S+ S Sbjct: 122 PPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEK 181 Query: 275 SGTTS 289 +GT + Sbjct: 182 AGTNN 186 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 6.0 Identities = 16/65 (24%), Positives = 24/65 (36%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP S LST + + T ST A +T +S + S+ S Sbjct: 122 PPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEK 181 Query: 275 SGTTS 289 +GT + Sbjct: 182 AGTNN 186 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 6.0 Identities = 16/65 (24%), Positives = 24/65 (36%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP S LST + + T ST A +T +S + S+ S Sbjct: 78 PPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEK 137 Query: 275 SGTTS 289 +GT + Sbjct: 138 AGTNN 142 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 6.0 Identities = 16/65 (24%), Positives = 24/65 (36%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP S LST + + T ST A +T +S + S+ S Sbjct: 122 PPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEK 181 Query: 275 SGTTS 289 +GT + Sbjct: 182 AGTNN 186 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 6.0 Identities = 16/65 (24%), Positives = 24/65 (36%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP S LST + + T ST A +T +S + S+ S Sbjct: 122 PPRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASSTSSTSSTEK 181 Query: 275 SGTTS 289 +GT + Sbjct: 182 AGTNN 186 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -2 Query: 312 TGEGAFGALVVPLVDPLIGAERP 244 TG G A ++P++ L+ + P Sbjct: 204 TGSGKTAAFMLPIIHNLLSDKNP 226 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 331 VPDALIYFDLF 363 VP L+YFD+F Sbjct: 223 VPRVLMYFDIF 233 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,741 Number of Sequences: 336 Number of extensions: 2321 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11352204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -