BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O08 (484 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57815.1 68418.m07230 cytochrome c oxidase subunit 6b, putati... 104 3e-23 At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putati... 99 2e-21 At4g28060.1 68417.m04025 cytochrome c oxidase subunit 6b, putati... 97 7e-21 At1g32710.1 68414.m04034 cytochrome c oxidase subunit VIb family... 52 2e-07 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 29 1.2 At5g54010.1 68418.m06718 glycosyltransferase family protein cont... 29 1.6 At4g08500.1 68417.m01401 mitogen-activated protein kinase kinase... 29 1.6 At4g00585.1 68417.m00082 expressed protein 29 2.2 At3g17205.1 68416.m02196 HECT-domain-containing protein / ubiqui... 29 2.2 At2g19010.1 68415.m02219 GDSL-motif lipase/hydrolase family prot... 29 2.2 At1g30490.1 68414.m03727 homeobox-leucine zipper transcription f... 29 2.2 At1g01240.3 68414.m00041 expressed protein 28 3.8 At1g01240.2 68414.m00040 expressed protein 28 3.8 At1g01240.1 68414.m00039 expressed protein 28 3.8 At5g55600.1 68418.m06932 agenet domain-containing protein / brom... 27 5.0 At5g44220.1 68418.m05410 F-box family protein similar to unknown... 27 5.0 At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica... 27 5.0 At4g34390.1 68417.m04885 extra-large guanine nucleotide binding ... 27 6.6 At1g61140.1 68414.m06888 SNF2 domain-containing protein / helica... 27 6.6 At5g67280.1 68418.m08483 leucine-rich repeat transmembrane prote... 27 8.8 At4g00060.1 68417.m00006 nucleotidyltransferase family protein c... 27 8.8 At1g71696.2 68414.m08283 carboxypeptidase D, putative similar to... 27 8.8 At1g71696.1 68414.m08284 carboxypeptidase D, putative similar to... 27 8.8 >At5g57815.1 68418.m07230 cytochrome c oxidase subunit 6b, putative similar to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] gi|6518353|dbj|BAA87883 Length = 78 Score = 104 bits (250), Expect = 3e-23 Identities = 41/71 (57%), Positives = 50/71 (70%) Frame = +1 Query: 100 DLKTAPFDPRFPNQNQTRHCYQSYVDFHRCQKVRGEKYEPCYYFKRVYRSLCPNEWVDKW 279 +LKTAP D RFP NQTRHC+ Y++FHRC +GE+ C F + YR+LCP EWVDKW Sbjct: 6 ELKTAPADFRFPTTNQTRHCFTRYIEFHRCTTAKGEESNDCERFAKYYRALCPGEWVDKW 65 Query: 280 DNQRAEGTFAG 312 + QR GTF G Sbjct: 66 NEQRESGTFPG 76 >At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putative (COX6b) nearly identical to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] GI:6518353 Length = 191 Score = 98.7 bits (235), Expect = 2e-21 Identities = 39/70 (55%), Positives = 49/70 (70%) Frame = +1 Query: 103 LKTAPFDPRFPNQNQTRHCYQSYVDFHRCQKVRGEKYEPCYYFKRVYRSLCPNEWVDKWD 282 L+TAP D RFP NQTRHC+ YV++HRC +G+ C F + YRSLCP+EWVD+W+ Sbjct: 119 LETAPADFRFPTTNQTRHCFTRYVEYHRCVAAKGDDAPECDKFAKFYRSLCPSEWVDRWN 178 Query: 283 NQRAEGTFAG 312 QR GTF G Sbjct: 179 EQRENGTFPG 188 >At4g28060.1 68417.m04025 cytochrome c oxidase subunit 6b, putative similar to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] gi|6518353|dbj|BAA87883 Length = 164 Score = 96.7 bits (230), Expect = 7e-21 Identities = 42/86 (48%), Positives = 52/86 (60%), Gaps = 6/86 (6%) Frame = +1 Query: 73 MPEMIKSPADLKTAPFDPRFPNQNQTRHCYQSYVDFHR------CQKVRGEKYEPCYYFK 234 + +K +LKTAP D RFP NQTRHC+ Y++FHR C +GE C F Sbjct: 77 LARFLKPRIELKTAPADFRFPTTNQTRHCFTRYIEFHRYSCVIECTTAKGEDANECERFA 136 Query: 235 RVYRSLCPNEWVDKWDNQRAEGTFAG 312 + YR+LCP EWVDKW+ QR GTF G Sbjct: 137 KYYRALCPGEWVDKWNEQRETGTFPG 162 >At1g32710.1 68414.m04034 cytochrome c oxidase subunit VIb family contains similarity to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] GI:6518353; contains Pfam profile PF02297: Cytochrome oxidase c subunit VIb Length = 134 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +1 Query: 112 APFDPRFPNQNQTRHCYQSYVDFHRCQKVRGEKYEPCYYFKRVYRSLCPNEWVDK 276 A + RFP N+TRHC+ ++ +H+C + G C + RS+CP E V K Sbjct: 59 AAVEERFPVTNETRHCFNRFMQYHKCIEKNGRDANDCNNLRDYVRSICPEELVSK 113 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 143 IRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGSTS 277 + + T T V W + K + ISR C+G++A G S Sbjct: 183 LSKATGTAVDWVQMIGMKPGPDSIGIVAISRNCSGIAARACGLVS 227 >At5g54010.1 68418.m06718 glycosyltransferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 29.1 bits (62), Expect = 1.6 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +2 Query: 173 WTSTVARKFAAKNTNHATISRECTGLSAPMSGSTSGTTSAP 295 W +AR++ K+ N TIS C +S S S P Sbjct: 118 WIPEIAREYGVKSVNFITISAACVAISFVPGRSQDDLGSTP 158 >At4g08500.1 68417.m01401 mitogen-activated protein kinase kinase, putative similar to mitogen-activated protein kinase MEKK1 GP|1255448 [Arabidopsis thaliana] Length = 608 Score = 29.1 bits (62), Expect = 1.6 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +2 Query: 146 RRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSA-PMSGSTSG-TTSAPKAPSPVGF 319 RRG +T + R+ AA+N N+ S C+ SA +S STS T + + P P F Sbjct: 14 RRGGDKNITPVRRLERRDAARNINYDAAS--CSSSSAEDLSVSTSSLMTRSLEFPEPTSF 71 Query: 320 R 322 R Sbjct: 72 R 72 >At4g00585.1 68417.m00082 expressed protein Length = 88 Score = 28.7 bits (61), Expect = 2.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 313 YRRRCLRRAGCPTCRPTHWGRET 245 +R + G P CRP HW R T Sbjct: 15 FRAKVWSMTGGPNCRPKHWRRNT 37 >At3g17205.1 68416.m02196 HECT-domain-containing protein / ubiquitin-transferase family protein weak similarity to ubiquitin-protein ligase 2 [Arabidopsis thaliana] GI:7108523; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 28.7 bits (61), Expect = 2.2 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +1 Query: 226 YFKRVYRSLCPNEWVDKWDNQRAEGTFAGRI*ILNVPD 339 +F R ++ L P EW+D ++ + +G + L++ D Sbjct: 723 HFLRGFQQLIPKEWIDMFNEHELQVLISGSVDSLDIDD 760 >At2g19010.1 68415.m02219 GDSL-motif lipase/hydrolase family protein similar to family II lipase EXL1 GI:15054382 from [Arabidopsis thaliana]; contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase Length = 344 Score = 28.7 bits (61), Expect = 2.2 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = -1 Query: 379 SFDLIKTNRNKLKHRERLGSKSYRRRCLRRAGC-PTCRPTHWGRETCTLS*NSSMVRIFR 203 ++ LI R+ LK+ RLG++ L + GC P +H + C+ N + V+IF Sbjct: 181 AYSLIIIYRSHLKNLHRLGARKVAVFGLSQIGCTPKIMKSHSDGKICSREVNEA-VKIFN 239 Query: 202 REL 194 + L Sbjct: 240 KNL 242 >At1g30490.1 68414.m03727 homeobox-leucine zipper transcription factor (HB-9) identical to HD-Zip protein GB:CAA71854 GI:2145358 from [Arabidopsis thaliana] Length = 841 Score = 28.7 bits (61), Expect = 2.2 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +2 Query: 149 RGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGSTS 277 + T T V W + K + +SR C+G++A G S Sbjct: 181 KATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGIAARACGLVS 223 >At1g01240.3 68414.m00041 expressed protein Length = 331 Score = 27.9 bits (59), Expect = 3.8 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVAR-KF-AAKNTNHATISRECTGLSAPMSG 268 PP K H S H S + TA K W V + +F + + N +T S+ + +S+P S Sbjct: 147 PPPQKLHKSIHSSSGEKGFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSD 206 Query: 269 STS 277 S Sbjct: 207 DLS 209 >At1g01240.2 68414.m00040 expressed protein Length = 331 Score = 27.9 bits (59), Expect = 3.8 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVAR-KF-AAKNTNHATISRECTGLSAPMSG 268 PP K H S H S + TA K W V + +F + + N +T S+ + +S+P S Sbjct: 147 PPPQKLHKSIHSSSGEKGFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSD 206 Query: 269 STS 277 S Sbjct: 207 DLS 209 >At1g01240.1 68414.m00039 expressed protein Length = 331 Score = 27.9 bits (59), Expect = 3.8 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 2/63 (3%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVAR-KF-AAKNTNHATISRECTGLSAPMSG 268 PP K H S H S + TA K W V + +F + + N +T S+ + +S+P S Sbjct: 147 PPPQKLHKSIHSSSGEKGFKTAVKSPWKQGVWKDRFERSLSYNGSTESKNTSPMSSPRSD 206 Query: 269 STS 277 S Sbjct: 207 DLS 209 >At5g55600.1 68418.m06932 agenet domain-containing protein / bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain and PF05641: Agenet domain Length = 663 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 16 WLPFSIEINPRNG*IIISNMPEMIKSPADLKTAPFD 123 W+P P I +SN P + +P D+KTA FD Sbjct: 432 WVPAFKSAMPDKLGIRLSNRPTIRPAPRDVKTAYFD 467 >At5g44220.1 68418.m05410 F-box family protein similar to unknown protein (pir||T06086) Length = 295 Score = 27.5 bits (58), Expect = 5.0 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +1 Query: 64 ISNMPEMIKSPADLKTAPFDPRF--PNQNQTRHCYQSYVDFHRCQKVRGEKYEPC--YY 228 +++ E+I +P L P+ + P + TR + H C+ +R +K PC YY Sbjct: 225 VTDAGELILAPISLPDPPYYVIYYDPQRQSTRKVVIRGITEHNCKLLRCKKRHPCILYY 283 >At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 981 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +2 Query: 152 GTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGSTSGT 283 GT KV W V + + ++R C GL A SGT Sbjct: 464 GTLAKVGWFRVVLDEAQTIKNHRTQVARACCGLRAKRRWCLSGT 507 >At4g34390.1 68417.m04885 extra-large guanine nucleotide binding protein, putative / G-protein, putative similar to extra-large G-protein (XLG) [Arabidopsis thaliana] GI:3201680; contains Pfam profile PF00503: G-protein alpha subunit Length = 861 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 70 NMPEMIKSPADLKTAPFDPRFPNQNQTRH 156 ++PE +KSPAD + +P P + + H Sbjct: 134 DVPEEVKSPADFRLSPSSPLSASAREEDH 162 >At1g61140.1 68414.m06888 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related similar to ATPase [Homo sapiens] GI:531196; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1287 Score = 27.1 bits (57), Expect = 6.6 Identities = 18/63 (28%), Positives = 26/63 (41%) Frame = +2 Query: 95 PPTSKQHLSTHGSLTKIRRGTATKVTWTSTVARKFAAKNTNHATISRECTGLSAPMSGST 274 PP SK+ S + + G KV+W V + + ++R C GL A Sbjct: 769 PPDSKKKGSKKKKV-EFLSGPLAKVSWFRVVLDEAQSIKNYKTQVARACWGLRAKRRWCL 827 Query: 275 SGT 283 SGT Sbjct: 828 SGT 830 >At5g67280.1 68418.m08483 leucine-rich repeat transmembrane protein kinase, putative Length = 751 Score = 26.6 bits (56), Expect = 8.8 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 242 TGLSAPMSGSTSGTTSAPKAPSP 310 TG SAP+ GS TTS PSP Sbjct: 609 TGGSAPIFGSKRSTTSLEFGPSP 631 >At4g00060.1 68417.m00006 nucleotidyltransferase family protein contains Pfam profile: PF01909 nucleotidyltransferase domain Length = 839 Score = 26.6 bits (56), Expect = 8.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 121 DPRFPNQNQTRHCYQSYVDFHRCQKVRGEKY 213 DP FP N R+C++ H+C K E Y Sbjct: 777 DPLFPTNNVGRNCFR----IHQCIKAFSEAY 803 >At1g71696.2 68414.m08283 carboxypeptidase D, putative similar to carboxypeptidase D [Anas platyrhynchos] gi|2789654|gb|AAB96915 Length = 491 Score = 26.6 bits (56), Expect = 8.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 142 NQTRHCYQSYVDFHRCQKVRGEKYE 216 N T +Q+Y D+HR V G+KYE Sbjct: 366 NYTVKAHQTYADYHRL-LVPGQKYE 389 >At1g71696.1 68414.m08284 carboxypeptidase D, putative similar to carboxypeptidase D [Anas platyrhynchos] gi|2789654|gb|AAB96915 Length = 422 Score = 26.6 bits (56), Expect = 8.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 142 NQTRHCYQSYVDFHRCQKVRGEKYE 216 N T +Q+Y D+HR V G+KYE Sbjct: 297 NYTVKAHQTYADYHRL-LVPGQKYE 320 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,987,832 Number of Sequences: 28952 Number of extensions: 183848 Number of successful extensions: 529 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 829097472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -