BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O05 (472 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42306| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.4) 28 3.4 SB_52387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 >SB_42306| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.4) Length = 444 Score = 28.3 bits (60), Expect = 3.4 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -1 Query: 73 RTMPITFNFKRIHRLY 26 +T+P FNF+++HRLY Sbjct: 399 KTVPFDFNFEKMHRLY 414 >SB_52387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1088 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -1 Query: 334 SLFYYKTVASRYPPAQSSASSNKKLAFFSIISSLHFLHA 218 SL Y VA + P +S KL FFS IS H L + Sbjct: 709 SLSYTTRVAVCFSPGIKKQASLAKLCFFSNISDQHLLRS 747 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,258,277 Number of Sequences: 59808 Number of extensions: 183403 Number of successful extensions: 411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -