BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O05 (472 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein ... 27 4.8 At2g06500.1 68415.m00720 hAT dimerisation domain-containing prot... 27 4.8 >At2g20320.1 68415.m02373 DENN (AEX-3) domain-containing protein contains Pfam domain PF02141: DENN (AEX-3) domain Length = 976 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 337 YSLFYYKTVASRYPPAQSSASSNKKLAFF 251 Y LF++ + +YPP + A K LA F Sbjct: 379 YQLFFHAQILFKYPPGKKVAMRPKDLATF 407 >At2g06500.1 68415.m00720 hAT dimerisation domain-containing protein / transposase-related low similarity to transposase [Ipomoea purpurea] AB004906 GI:4063770 Length = 582 Score = 27.5 bits (58), Expect = 4.8 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Frame = -2 Query: 132 FSKFTGVKNYRKSTINQLSFEPCRSLSI---LKEFIDY--TLEEFIGR 4 FSK +KNY +ST++Q LSI + E IDY +++F G+ Sbjct: 526 FSKLKLIKNYLRSTMSQDRLNGLAILSIERAMLEKIDYATVMDDFAGK 573 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,286,424 Number of Sequences: 28952 Number of extensions: 133576 Number of successful extensions: 292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -