BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O02 (782 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 25 0.79 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 25 0.79 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 25 0.79 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 2.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 7.4 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 9.8 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 9.8 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 9.8 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.79 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 555 SSPPREFRYFCPPG 514 S P ++RYFCP G Sbjct: 276 SENPADYRYFCPDG 289 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.79 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 555 SSPPREFRYFCPPG 514 S P ++RYFCP G Sbjct: 276 SENPADYRYFCPDG 289 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.79 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 555 SSPPREFRYFCPPG 514 S P ++RYFCP G Sbjct: 276 SENPADYRYFCPDG 289 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.4 bits (48), Expect = 2.4 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = +2 Query: 107 TVTILRKKPPKASALKTEQAVNAARRQGIPVDTQQKYGAGTNKQHVTTKNTAKLDRETEE 286 T TI K KA + + ARR+GI + A TT + A LDR E Sbjct: 479 TGTISANKASKAFGIPSSTLYKIARREGIRL-------AAPFNASPTTWSPADLDRALEA 531 Query: 287 LR 292 +R Sbjct: 532 IR 533 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -2 Query: 526 LSARRLQWLA--SFFSTKFYSNCPFNFSK 446 ++A WL+ SFF F+ CP F + Sbjct: 409 VNAGMWMWLSCSSFFQQFFHCYCPVRFGR 437 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 Query: 718 YFKISGNERKY 750 Y+KISGN ++Y Sbjct: 35 YYKISGNGKQY 45 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 110 VTILRKKPPKASAL 151 +TIL KKP ++S L Sbjct: 544 ITILEKKPSRSSTL 557 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 Query: 718 YFKISGNERKY 750 Y+KISGN ++Y Sbjct: 35 YYKISGNGKQY 45 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,436 Number of Sequences: 438 Number of extensions: 4332 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -