BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_O02 (782 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42680.1 68415.m05283 ethylene-responsive transcriptional coa... 138 3e-33 At3g58680.1 68416.m06540 ethylene-responsive transcriptional coa... 137 9e-33 At3g24500.1 68416.m03073 ethylene-responsive transcriptional coa... 112 2e-25 At1g67220.1 68414.m07651 zinc finger protein-related similar to ... 31 1.1 At2g21890.1 68415.m02601 mannitol dehydrogenase, putative simila... 30 2.0 At2g21490.1 68415.m02557 dehydrin family protein contains Pfam d... 29 4.6 At5g51500.1 68418.m06387 pectinesterase family protein contains ... 28 8.0 At5g11530.1 68418.m01345 embryonic flower 1 (EMF1) identical to ... 28 8.0 At4g32695.1 68417.m04654 hypothetical protein hypothetical prote... 28 8.0 At4g09980.1 68417.m01634 methyltransferase MT-A70 family protein... 28 8.0 >At2g42680.1 68415.m05283 ethylene-responsive transcriptional coactivator, putative similar to ethylene-responsive transcriptional coactivator [Lycopersicon esculentum] gi|5669634|gb|AAD46402 Length = 142 Score = 138 bits (335), Expect = 3e-33 Identities = 67/134 (50%), Positives = 93/134 (69%), Gaps = 2/134 (1%) Frame = +2 Query: 98 DWDTVTILRKKPPKASALKTEQAVNAARRQGIPVDTQQKYGAGTNK--QHVTTKNTAKLD 271 DW+ V ++RKKP A+A + E+ VNAARR G ++T +K+ AGTNK T+ NT LD Sbjct: 10 DWEPV-VIRKKPANAAAKRDEKTVNAARRSGADIETVRKFNAGTNKAASSGTSLNTKMLD 68 Query: 272 RETEELRHEKIPLDLGKLIMQGRQAKGMSQKDLATKICEKPQIVNDYEAGRGIPNNIVLG 451 +TE L HE++P +L K IMQ R K ++Q LA I EKPQ++ +YE+G+ IPN +L Sbjct: 69 DDTENLTHERVPTELKKAIMQARTDKKLTQSQLAQIINEKPQVIQEYESGKAIPNQQILS 128 Query: 452 KIERAIGIKLRGKE 493 K+ERA+G KLRGK+ Sbjct: 129 KLERALGAKLRGKK 142 >At3g58680.1 68416.m06540 ethylene-responsive transcriptional coactivator, putative similar to ethylene-responsive transcriptional coactivator [Lycopersicon esculentum] gi|5669634|gb|AAD46402 Length = 142 Score = 137 bits (331), Expect = 9e-33 Identities = 65/134 (48%), Positives = 94/134 (70%), Gaps = 2/134 (1%) Frame = +2 Query: 98 DWDTVTILRKKPPKASALKTEQAVNAARRQGIPVDTQQKYGAGTNK--QHVTTKNTAKLD 271 DW+ V ++RK+ P A+A + E+ VNAARR G ++T +K+ AG+NK T+ NT KLD Sbjct: 10 DWEPV-VIRKRAPNAAAKRDEKTVNAARRSGADIETVRKFNAGSNKAASSGTSLNTKKLD 68 Query: 272 RETEELRHEKIPLDLGKLIMQGRQAKGMSQKDLATKICEKPQIVNDYEAGRGIPNNIVLG 451 +TE L H+++P +L K IMQ R K ++Q LA I EKPQ++ +YE+G+ IPN +L Sbjct: 69 DDTENLSHDRVPTELKKAIMQARGEKKLTQSQLAHLINEKPQVIQEYESGKAIPNQQILS 128 Query: 452 KIERAIGIKLRGKE 493 K+ERA+G KLRGK+ Sbjct: 129 KLERALGAKLRGKK 142 >At3g24500.1 68416.m03073 ethylene-responsive transcriptional coactivator, putative similar to ethylene-responsive transcriptional coactivator [Lycopersicon esculentum] gi|5669634|gb|AAD46402 Length = 148 Score = 112 bits (270), Expect = 2e-25 Identities = 57/135 (42%), Positives = 86/135 (63%), Gaps = 4/135 (2%) Frame = +2 Query: 98 DWDTVTILRKKPPKASALKTEQAVNAARRQGIPVDTQQKYGAGTNKQHVTTK----NTAK 265 DW+ V +L K K+ L+ +AVNAA R G+ V T +K+ AG+NK+ +T NT K Sbjct: 12 DWEPV-VLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKKFDAGSNKKGKSTAVPVINTKK 70 Query: 266 LDRETEELRHEKIPLDLGKLIMQGRQAKGMSQKDLATKICEKPQIVNDYEAGRGIPNNIV 445 L+ ETE +++ ++ +I + R K MSQ DLA +I E+ Q+V +YE G+ +PN V Sbjct: 71 LEEETEPAAMDRVKAEVRLMIQKARLEKKMSQADLAKQINERTQVVQEYENGKAVPNQAV 130 Query: 446 LGKIERAIGIKLRGK 490 L K+E+ +G+KLRGK Sbjct: 131 LAKMEKVLGVKLRGK 145 >At1g67220.1 68414.m07651 zinc finger protein-related similar to SP|Q09472 E1A-associated protein p300 {Homo sapiens}, SP|Q92793 CREB-binding protein {Homo sapiens}; contains Pfam profiles PF00569: Zinc finger ZZ type, PF00628: PHD-finger, PF02135: TAZ zinc finger Length = 1357 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +2 Query: 137 KASALKTEQAVNAARRQGIPVDTQQ--KYGAGTNKQHVTTKNTAKLDRETEELRHEK 301 K + E+++N ++ GI VD + K GT K VTT N K+ E L +EK Sbjct: 444 KGNTQTEERSLNHEKKLGIGVDIVEPMKCDEGT-KCEVTTTNKGKIQTEERSLNYEK 499 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 137 KASALKTEQAVNAARRQGIPVDTQQ--KYGAGTNKQHVTTKNTAKLDRETEELRHEK 301 K + E ++N ++ G VD + K GT K VTT N K+ E L HEK Sbjct: 362 KGNIQTEESSLNHEKKLGTVVDIVEPMKCDEGT-KCEVTTTNKGKIHTEERSLNHEK 417 >At2g21890.1 68415.m02601 mannitol dehydrogenase, putative similar to ELI3-2 (SP|Q02972), sinapyl alcohol dehydrogenase (Populus tremuloides) (gi:14279694); contains Pfam zinc-binding dehydrogenase domain PF00107 Length = 375 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 305 PLDLGKLIMQGRQAKGMSQKDLATKICEKPQIVNDYE 415 PL LG+ ++ G Q GM + + C K +IV+D E Sbjct: 285 PLVLGRKMVGGSQIGGMKETQEMLEFCAKHKIVSDIE 321 >At2g21490.1 68415.m02557 dehydrin family protein contains Pfam domain, PF00257: Dehydrin Length = 185 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/61 (22%), Positives = 26/61 (42%) Frame = +2 Query: 119 LRKKPPKASALKTEQAVNAARRQGIPVDTQQKYGAGTNKQHVTTKNTAKLDRETEELRHE 298 LR+ +S+ + R++ I ++K+G+G +K T T + HE Sbjct: 105 LRRSGSSSSSSSEDDGQGGRRKKSIKEKIKEKFGSGKHKDEQTPATATTTGPATTDQPHE 164 Query: 299 K 301 K Sbjct: 165 K 165 >At5g51500.1 68418.m06387 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 540 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 126 LRRIVTVSQSDMFNVDHWYDKTKQEY 49 LR + TV+ + N+D W DKT Y Sbjct: 24 LRPLTTVADGNSTNIDGWCDKTPYPY 49 >At5g11530.1 68418.m01345 embryonic flower 1 (EMF1) identical to embryonic flower 1 [Arabidopsis thaliana] GI:15430697 Length = 1096 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/70 (22%), Positives = 37/70 (52%) Frame = +2 Query: 158 EQAVNAARRQGIPVDTQQKYGAGTNKQHVTTKNTAKLDRETEELRHEKIPLDLGKLIMQG 337 ++ + A R+G V Q+ +GA ++ H + T TEE ++ IP+++ +L+ + Sbjct: 568 QKDASGADRKGKTVMVQEHHGAPRSQSHDRKETT------TEEQNNDDIPMEIVELMAKN 621 Query: 338 RQAKGMSQKD 367 + + + K+ Sbjct: 622 QYERCLPDKE 631 >At4g32695.1 68417.m04654 hypothetical protein hypothetical protein yjbI, Bacillus subtilis, PIR2:A69844 Length = 412 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +2 Query: 161 QAVNAARRQGIPVDTQQKYGAGTNKQHVTTKN-TAKLDRETEELRHEKIPLDLGKLIMQG 337 +A+ A IP++ A QHVT + + K D+ TE+L LDL ++ ++ Sbjct: 183 EAIQVADGLTIPIENFGSVEAKVRDQHVTILSCSKKTDKCTEKLERS---LDLDEIRVKD 239 Query: 338 RQAKGMSQ 361 + A G S+ Sbjct: 240 KDAIGFSK 247 >At4g09980.1 68417.m01634 methyltransferase MT-A70 family protein low similarity to SP|P25583 Karyogamy protein KAR4 {Saccharomyces cerevisiae}, (N6-adenosine)-methyltransferase [Mus musculus] GI:10179948; contains Pfam profile PF05063: MT-A70 (S-adenosylmethionine-binding subunit of human mRNA:m6A methyl-transferase (MTase)) Length = 775 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 552 SPPREFRYFCPPGGCSGWPLSFPRSFI 472 +PP +F PPG G P +FP S I Sbjct: 506 TPPNPNMFFTPPGSDRGGPPNFPGSNI 532 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,588,038 Number of Sequences: 28952 Number of extensions: 308682 Number of successful extensions: 744 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 741 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -