BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P02_F_O01
(710 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z70286-7|CAA94292.3| 431|Caenorhabditis elegans Hypothetical pr... 28 7.6
>Z70286-7|CAA94292.3| 431|Caenorhabditis elegans Hypothetical
protein K08C7.1 protein.
Length = 431
Score = 27.9 bits (59), Expect = 7.6
Identities = 15/40 (37%), Positives = 22/40 (55%)
Frame = +2
Query: 557 KQFIIQHLYFFVTNILINFHLLNYILCKNYTLLTTIRNIL 676
KQF Q + F + LI H LN++ +N T+L I I+
Sbjct: 48 KQFTFQSVGFGLAVGLIPLHFLNFLGTRNVTILYGIVGII 87
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,096,142
Number of Sequences: 27780
Number of extensions: 268533
Number of successful extensions: 659
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 643
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 659
length of database: 12,740,198
effective HSP length: 79
effective length of database: 10,545,578
effective search space used: 1655655746
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -