BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_N18 (763 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 30 2.4 SB_18564| Best HMM Match : ShTK (HMM E-Value=6.5) 30 2.4 SB_12663| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_53154| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_19778| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_36995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_9537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.5 bits (78), Expect = 0.047 Identities = 28/117 (23%), Positives = 44/117 (37%), Gaps = 5/117 (4%) Frame = +3 Query: 411 RSCLERCPRPLMERCPC-CCSFMERCPSSFLEXXXXXXXXXXXXXXXXXXXXXXLGRSIC 587 + C E CP+ CP CCS + CP++ L C Sbjct: 1718 KECKESCPKVCGPGCPVQCCSDLNICPANCTGSACKPGCITIEDSVTVSLGNDKLCPEAC 1777 Query: 588 R*VRC--SCPTTMERPSSPGLECPRPPGLERSRSPGLECSR--SPIMERSSLLAIRC 746 +C SCP+T +SP + CP+ + + C + SP E ++ A +C Sbjct: 1778 L-TKCLPSCPSTCCIKNSPPVVCPKSCETTCTPDCPVMCCKNSSPATECPTICASKC 1833 >SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 710 W*AGAFQSW*AGAFQSWWAGAFQSW 636 W G SW +G SW++G SW Sbjct: 533 WFYGVLSSWFSGELSSWFSGELSSW 557 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = -3 Query: 758 W*AGAPDCQEGAPFHDW*AGAFQSW*AGAFQSWWAGAFQSW*AGAF 621 W G W G F SW G SW+ G W G F Sbjct: 143 WFYGELSSSLSGELSSWFYGEFSSWFYGEISSWFYGELSFWFYGEF 188 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = -3 Query: 758 W*AGAPDCQEGAPFHDW*AGAFQSW*AGAFQSWWAGAFQSW*AGAF 621 W G W G F SW G SW+ G W G F Sbjct: 389 WFYGELSSSLSGELSSWFYGEFSSWFYGEISSWFYGELSFWFYGEF 434 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -3 Query: 710 W*AGAFQSW*AGAFQSWWAGAFQSW*AGAF 621 W G F SW G SW+ G W G F Sbjct: 63 WFYGEFSSWFYGEISSWFYGELSFWFYGEF 92 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -3 Query: 719 FHDW*AGAFQSW*AGAFQSWWAGAFQSW 636 F W G SW G W+ G F SW Sbjct: 68 FSSWFYGEISSWFYGELSFWFYGEFSSW 95 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -3 Query: 719 FHDW*AGAFQSW*AGAFQSWWAGAFQSW 636 F W G SW G W+ G F SW Sbjct: 164 FSSWFYGEISSWFYGELSFWFYGEFSSW 191 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -3 Query: 719 FHDW*AGAFQSW*AGAFQSWWAGAFQSW 636 F W G SW G W+ G F SW Sbjct: 410 FSSWFYGEISSWFYGELSFWFYGEFSSW 437 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 704 AGAFQSW*AGAFQSWWAGAFQSW*AG 627 +G SW G SW++G SW +G Sbjct: 527 SGELSSWFYGVLSSWFSGELSSWFSG 552 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 Query: 701 GAFQSW*AGAFQSWWAGAFQSW 636 G SW G F SW+ G SW Sbjct: 58 GELSSWFYGEFSSWFYGEISSW 79 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/41 (29%), Positives = 13/41 (31%) Frame = -3 Query: 758 W*AGAPDCQEGAPFHDW*AGAFQSW*AGAFQSWWAGAFQSW 636 W G W G SW G SW+ G SW Sbjct: 95 WFYGELSSSLSGELSSWLYGELSSWFYGELSSWFYGELSSW 135 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +3 Query: 603 SCPTTMERPSSPGLECPR--PPGLERSRSPGLECSRSPIMERSSLLAIRCPRS 755 S P P + L PR P R++SP L +PI E S L +R P++ Sbjct: 2309 STPVPKSSPINSPLTSPRDSPVPFSRAKSPQLSVDFAPITESSVKLNVRLPQT 2361 >SB_18564| Best HMM Match : ShTK (HMM E-Value=6.5) Length = 348 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +3 Query: 600 CSCPTTMERPSSPGLECPRPPGLERSRSPGLECSRSPIMERSSLLAIRCPRSP 758 C+ +++E P EC P E + P EC+ P E + +L++ C P Sbjct: 157 CALISSLECAFIPSSECALIPCSECALIPSSECALIPSSESALILSLECALIP 209 >SB_12663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 654 RPPGLERSRSPGLECSRSPIMERSSLLAIRCPRSP 758 R PG++ +RSPG + +RSP + + L + RSP Sbjct: 3 RSPGIQVARSPGRQVARSPGHQVARSLGRQVARSP 37 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 633 SPGLECPRPPGLERSRSPGLECSRS 707 SPG++ R PG + +RSPG + +RS Sbjct: 4 SPGIQVARSPGRQVARSPGHQVARS 28 >SB_53154| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 713 DW*AGAFQSW*AGAFQSWWAGAFQSW*AG 627 DW AG W AG W AG W AG Sbjct: 227 DWMAGWLAGWLAGWLAGWLAGWLAGWLAG 255 >SB_19778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 609 PTTMERPSSPGLECPRPPGLERSRSP-GLECSRSP 710 PTT E P P + P+PP + S+ P GL R P Sbjct: 452 PTTTETPIVPTVPGPQPPIIVGSKGPDGLRGYRGP 486 >SB_36995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 21 RHSDSWKSLVFQQRYQPTKTNTIFIFLSLFHFCASFHYEN 140 R W ++F + Q K IF+ S CA H+EN Sbjct: 460 RRQKDWFEIIFWESGQANKHFPIFVRASDLEACARTHHEN 499 >SB_9537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 612 TTMERPSSPGLECPRPPGLERSRSPGLECSRSP 710 +T P+ PG RP ER R LEC P Sbjct: 50 STWTIPTDPGYNTRRPSSAERYRQSPLECRPKP 82 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 646 NAPAHQDWNAPAHQDWNAPAHQSWNGAPSWQSGAPAHXP 762 N P +Q N P +Q N P +Q N + + P + P Sbjct: 214 NQPTNQPTNQPTNQPTNQPTNQPTNQPTNQPTNQPTNQP 252 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 646 NAPAHQDWNAPAHQDWNAPAHQSWNGAPSWQSGAPAHXP 762 N P +Q N P +Q N P +Q N + + P + P Sbjct: 218 NQPTNQPTNQPTNQPTNQPTNQPTNQPTNQPTNQPTNQP 256 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 274 ARAAHISALQQASKNNPNPNDDGSYDPRWDNEE 372 ++A I L++ SK + + +DD YD DNE+ Sbjct: 44 SKATGIKPLERESKEDNDRDDDDDYDDDVDNED 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.127 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,108,108 Number of Sequences: 59808 Number of extensions: 354650 Number of successful extensions: 1391 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1369 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -