BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_N07 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_45809| Best HMM Match : Vicilin_N (HMM E-Value=4.5) 33 0.21 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_12095| Best HMM Match : Vicilin_N (HMM E-Value=0.083) 32 0.36 SB_22132| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) 31 0.83 SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) 29 2.5 SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) 29 2.5 SB_16982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) 29 3.4 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 29 4.4 SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 28 5.9 SB_1172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_56025| Best HMM Match : Keratin_B2 (HMM E-Value=0.4) 28 7.7 SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 28 7.7 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 28 7.7 SB_58222| Best HMM Match : HS1_rep (HMM E-Value=0) 28 7.7 SB_36320| Best HMM Match : LUC7 (HMM E-Value=0.083) 28 7.7 SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) 28 7.7 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 34.7 bits (76), Expect = 0.067 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 6/78 (7%) Frame = -1 Query: 424 KLRDRNPSERHEQQRLSGLQE---RSQRNEPRARRPQSGPEREC---VQERGPCARRR*I 263 K R+R ER +QQ+L +E R Q+ E + RR + ++ QER A++ Sbjct: 184 KRREREQKEREKQQKLDMEKEERRRRQQEEEKKRREEEEKRKKVEKEKQEREKAAKKNIK 243 Query: 262 QSEHQQRSRQCA*YRQIP 209 + + QQR+ Q R+IP Sbjct: 244 RQQQQQRTDQQQYPREIP 261 Score = 30.7 bits (66), Expect = 1.1 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 2/83 (2%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQ--ERGPCARR 272 K + K + R E +Q+RL + RSQ NE R RR + ERE Q + RR Sbjct: 149 KRKEEEEKEKQRKQLEVEKQKRLEEERIRSQ-NEERKRREREQKEREKQQKLDMEKEERR 207 Query: 271 R*IQSEHQQRSRQCA*YRQIPRE 203 R Q E ++R + +++ +E Sbjct: 208 RRQQEEEKKRREEEEKRKKVEKE 230 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 34.7 bits (76), Expect = 0.067 Identities = 25/73 (34%), Positives = 32/73 (43%) Frame = -1 Query: 451 SPKERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARR 272 SP+ RRR D +P R E R R + E R RR S P R+ + P RR Sbjct: 832 SPRRRRRSASGSDSSPHRRSESPR----DRRRRSPEHRRRREASPPRRDRKRYDSPPRRR 887 Query: 271 R*IQSEHQQRSRQ 233 R S +R R+ Sbjct: 888 RRSPSPPPRRRRR 900 >SB_45809| Best HMM Match : Vicilin_N (HMM E-Value=4.5) Length = 215 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRAR 332 +ERRR +K RDR+ R +R S ER R + R+R Sbjct: 33 RERRRRSKSRDRDSRSRTSSRRRSRSSERRHRKDDRSR 70 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRAR 332 +ERRR +K RDR+ R +R S ER R + R+R Sbjct: 1603 RERRRRSKSRDRDSRSRTSSRRRSRSSERRHRKDDRSR 1640 >SB_12095| Best HMM Match : Vicilin_N (HMM E-Value=0.083) Length = 501 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/55 (30%), Positives = 32/55 (58%) Frame = -1 Query: 439 RRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCAR 275 RRRL L++ + E+Q + +QER++++ RAR + +R+ ++E C R Sbjct: 302 RRRLKALQEAEQALEEERQCRTKMQERAEQSVERAREEMTDWKRQ-IEELSGCCR 355 >SB_22132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 0.63 Identities = 16/71 (22%), Positives = 42/71 (59%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR* 266 +++++L + + + P + +QQ+ L+++ Q+ +PR ++ Q P + Q++ P +++ Sbjct: 60 QQQQQLQQQQQQQPRLQQQQQQQPRLKQQQQQ-QPRLKQQQQQPRLKQQQQQQPRLKQQQ 118 Query: 265 IQSEHQQRSRQ 233 Q QQ+ +Q Sbjct: 119 QQPRLQQQQQQ 129 >SB_9843| Best HMM Match : LIM (HMM E-Value=8.4e-07) Length = 2128 Score = 31.1 bits (67), Expect = 0.83 Identities = 29/89 (32%), Positives = 40/89 (44%), Gaps = 5/89 (5%) Frame = -1 Query: 448 PKERRRLTKLRDRNPS----ERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPC 281 PKE R R R PS +RHE +R G E +R + RR ER+ + R Sbjct: 1595 PKEEPRQGTERRREPSLRHDDRHEDRRSEGRPEDYERRDEERRRE---AERKGERPREEF 1651 Query: 280 ARRR*IQSEHQQRS-RQCA*YRQIPREST 197 R+ S+ QRS R+ Y + RE + Sbjct: 1652 ERKSERSSQRSQRSLREGERYYEERREES 1680 >SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 942 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -1 Query: 439 RRRLTKLRDRNPS--ERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR* 266 R R TK + ++PS R + R S ER R R+R P+S R + RRR Sbjct: 312 RERNTKRKSKSPSLERRRSRARRSRSIERRDRRRSRSRSPRSSLGRSRRRSSSRNRRRRR 371 Query: 265 IQSEHQQRSR-QCA*YRQIPREST 197 +S+ ++ QC +++ R + Sbjct: 372 SRSKSPLNTKSQCEKEQRVSRSKS 395 >SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 409 NPSERHEQQRLSGLQERSQRNEPRARRPQSGP 314 NPS++ +++ + E +R EP P++GP Sbjct: 397 NPSQKKDEEEMEEEDEEEEREEPDEPEPETGP 428 >SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/54 (31%), Positives = 34/54 (62%), Gaps = 2/54 (3%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQE--RSQRNEPRARRPQSGPERECVQER 290 ++++R + +DR+ + E ++ S +E R +R+E R +RP+S ERE ++R Sbjct: 229 EDKKREEEKKDRDKDKDREDRKSSSSRESKRERRSEEREKRPRS-RERERSRDR 281 >SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) Length = 1072 Score = 29.5 bits (63), Expect = 2.5 Identities = 23/70 (32%), Positives = 36/70 (51%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR* 266 KE+ R K R+R +R +++ + ++ R R+ RAR P G R + P +RRR Sbjct: 1004 KEQER-EKERERLREQREKEREETRMRARD-RSGDRARSPPRGRARS----KSPVSRRRA 1057 Query: 265 IQSEHQQRSR 236 S + RSR Sbjct: 1058 SPSRSRSRSR 1067 >SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 794 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/82 (26%), Positives = 35/82 (42%) Frame = -1 Query: 442 ERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR*I 263 ER+R K R+R E++R + +R R R + ERE +ER R Sbjct: 205 ERQR-EKERERERERERERERERERERERERERERERERERERERERERERERERERERE 263 Query: 262 QSEHQQRSRQCA*YRQIPREST 197 + ++R R+ Y + ST Sbjct: 264 RERERERERERKRYACVSETST 285 >SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) Length = 287 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 Query: 101 ATTPASPTACQTPTPATSRASTRPASV 181 A PA+P+A P P S ST P+SV Sbjct: 114 APAPAAPSAAAAPAPVRSVPSTSPSSV 140 >SB_16982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 403 SERHEQQRLSGLQERSQRNEPRARRPQSGPER 308 SER ++R SGLQERS+ R+R P+ R Sbjct: 203 SERTRKRRHSGLQERSRDRIARSRSPRRSRAR 234 >SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) Length = 426 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/70 (30%), Positives = 30/70 (42%) Frame = -1 Query: 442 ERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR*I 263 ER+R + L R+ SER R+S RS + + R P R +R AR R Sbjct: 47 ERKRPSSL-GRDSSERRPSARVSSDNSRSPPHRRDSSRRSHSPSRRSSDDRSTDARDRRD 105 Query: 262 QSEHQQRSRQ 233 + R R+ Sbjct: 106 RRRSSSRERR 115 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 28.7 bits (61), Expect = 4.4 Identities = 22/72 (30%), Positives = 34/72 (47%) Frame = -1 Query: 451 SPKERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARR 272 SP++R R + R+P +R R +RS+ R+R P+ G + R P RR Sbjct: 196 SPRKRSRSPRKMLRSPRKRSRTPR-----KRSRSPRKRSRSPRKGSHTPKKRSRSP--RR 248 Query: 271 R*IQSEHQQRSR 236 H++RSR Sbjct: 249 N--SQRHKERSR 258 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/84 (23%), Positives = 34/84 (40%) Frame = -1 Query: 451 SPKERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARR 272 SP++R R + R R+P +R R + + PR R Q ER +R Sbjct: 210 SPRKRSRTPRKRSRSPRKRSRSPRKGSHTPKKRSRSPR-RNSQRHKERSRYHRSRSRSRH 268 Query: 271 R*IQSEHQQRSRQCA*YRQIPRES 200 R +S + +++ R+S Sbjct: 269 RRSRSNSPSMRKSDRKFKKSQRKS 292 >SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/62 (20%), Positives = 34/62 (54%) Frame = -1 Query: 418 RDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR*IQSEHQQRS 239 R ++ +QQ+ Q++ Q+ + + ++PQ +++ QE+ +++ Q + QQ+ Sbjct: 12 RGSTKQQQQQQQQQQQQQQQQQQQQQQQQQPQPQQQQQQQQEQEQQQQQQQQQQQQQQQQ 71 Query: 238 RQ 233 +Q Sbjct: 72 QQ 73 >SB_540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -1 Query: 451 SPKERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQER 290 S E+R K + R ++ +Q+R +++ R E R RR + + E +ER Sbjct: 79 SDSEKRPKGKEKSRKDADDSDQERDRSKRDKKDRKEKRDRRSKERSKDESKEER 132 >SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 28.7 bits (61), Expect = 4.4 Identities = 21/70 (30%), Positives = 30/70 (42%) Frame = -1 Query: 442 ERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR*I 263 ER+R + L R+ SER R+S RS + + R P R +R AR R Sbjct: 47 ERKRPSSL-GRDSSERRPSVRVSSDNSRSPPHRRDSSRRSHSPSRRSSDDRSTDARDRRD 105 Query: 262 QSEHQQRSRQ 233 + R R+ Sbjct: 106 RRRSSSRERR 115 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -1 Query: 451 SPKERRRLTKLRDRNPSERHEQQRL-SGLQERSQRNEPRARRPQSGPERECVQER 290 SP R ++ R R+P RH + R + + RS+ + P ++ + ++E ++R Sbjct: 250 SPHHRSHRSRSRSRSPRRRHSRSRSPTHRRHRSRSHSPEKKKHKKKEKKEKDEKR 304 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = -1 Query: 451 SPKERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERG 287 SP+ R R R R+P ++ R G ++R R+ R R G +R+ +++G Sbjct: 448 SPRRRSRSPGHRSRSPRRGRDRDRDRG-RDRRDRDRDRDRDRDRGRDRDRDKDKG 501 >SB_1172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/69 (17%), Positives = 38/69 (55%) Frame = -1 Query: 439 RRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR*IQ 260 +RR+T + ++ +QQ+ Q++ Q+ + + ++ Q +++ +++ +++ Q Sbjct: 25 KRRVTAAPSKTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQKQQQQQQQQQQQQ 84 Query: 259 SEHQQRSRQ 233 + QQ+ +Q Sbjct: 85 QQRQQQQQQ 93 >SB_56025| Best HMM Match : Keratin_B2 (HMM E-Value=0.4) Length = 187 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 101 ATTPASPTACQTPTPATSRASTR-PASVTA**DSTLS 208 A T PT TPT AT ST P+ VT D LS Sbjct: 115 APTTTKPTTATTPTSATKGLSTEGPSPVTKGVDGALS 151 >SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 583 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = -1 Query: 424 KLRDRNPSERHEQQRLSGLQERSQRNEPRARRP-QSGPERECVQERGPCARRR*IQSEHQ 248 +L + P E + S +ERSQ +RP + +E QE+ +R + H+ Sbjct: 425 RLEEERPEEERTHEERSH-KERSQEKRSHEKRPHEERSHKERSQEKRSHEKRPHEERSHE 483 Query: 247 QRSRQ 233 +RS + Sbjct: 484 ERSEE 488 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 109 TSFSYGVSDPHTGDVKSQHETRVGDSVVGQYSLLES 216 TS + +SD H+G + + + ++GDS + + S + S Sbjct: 2740 TSIAEELSDRHSGSSEVEEDIKIGDSSISEASEIRS 2775 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Frame = -1 Query: 418 RDRNPSERHEQQRLSGLQ---ERSQRNEPRARRPQSGPERECVQERGPCARRR*IQSEHQ 248 RDRN + ++++R + E+ +R++ R + + ERE +ER R +S H+ Sbjct: 613 RDRNREKENDREREKEREKEKEKEERDKEREKEKEKEKEREKEKEREREKERDRDKSSHK 672 Query: 247 QR 242 +R Sbjct: 673 KR 674 >SB_58222| Best HMM Match : HS1_rep (HMM E-Value=0) Length = 727 Score = 27.9 bits (59), Expect = 7.7 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 8/60 (13%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQERSQRN--------EPRARRPQSGPERECVQER 290 K+RR+ + R+R ++R ++ + E S+R E ARR Q ERE + R Sbjct: 394 KQRRQAKEQREREAAQRRQEMEAAKDAEASEREAEAERAAAEDEARRQQEEAEREAEEAR 453 >SB_36320| Best HMM Match : LUC7 (HMM E-Value=0.083) Length = 216 Score = 27.9 bits (59), Expect = 7.7 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQE-RSQRNEPRARRPQSGPERECVQERGPCAR 275 +++RR + R+R R +R SG ++ RS R+ R RR +S + R AR Sbjct: 107 RQKRREEREREREQERREMDKRRSGDRDRRSSRDADRGRRRRSRSRSRDHKRRSLLAR 164 >SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) Length = 2565 Score = 27.9 bits (59), Expect = 7.7 Identities = 23/79 (29%), Positives = 33/79 (41%) Frame = -1 Query: 439 RRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR*IQ 260 R+R KLR R R +R+ + R +R + RR + R P RRR Sbjct: 359 RKRARKLRRRRNRRRRRLRRIRRRRRRRRRRRRKLRRR---------RRRRPLRRRRRRG 409 Query: 259 SEHQQRSRQCA*YRQIPRE 203 ++R RQ +PRE Sbjct: 410 GRRRRRGRQGRGGYDLPRE 428 >SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1329 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 412 RNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERE 305 RNPS R + R SGL Q RR QS RE Sbjct: 424 RNPSPRSARHRFSGLLRTVQATVRTERRAQSQLPRE 459 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,381,362 Number of Sequences: 59808 Number of extensions: 238777 Number of successful extensions: 1312 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1285 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -