BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_N07 (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51840.1 68416.m05685 short-chain acyl-CoA oxidase identical ... 32 0.39 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 30 1.6 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 30 1.6 At1g28420.1 68414.m03494 homeobox transcription factor, putative... 29 2.1 At2g27285.1 68415.m03279 expressed protein weak similarity to ma... 29 2.7 At5g37010.1 68418.m04438 expressed protein 29 3.6 At4g15180.1 68417.m02328 SET domain-containing protein contains ... 29 3.6 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 28 4.8 At2g19710.1 68415.m02303 expressed protein contains Pfam profi... 28 6.3 >At3g51840.1 68416.m05685 short-chain acyl-CoA oxidase identical to Short-chain acyl CoA oxidase [Arabidopsis thaliana] GI:5478795; contains InterPro entry IPR006089: Acyl-CoA dehydrogenase Length = 436 Score = 31.9 bits (69), Expect = 0.39 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 236 TVRLVPSDSKRE-YCPTTLSPTRVSCWLLTSPVWGSD 129 T+ L S++++E Y P+ V+CW LT P GSD Sbjct: 146 TIALCGSEAQKEKYLPSLAQLNTVACWALTEPDNGSD 182 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.9 bits (64), Expect = 1.6 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 5/77 (6%) Frame = -1 Query: 451 SPKERRRLTKL----RDRNPSERHEQQRLSGLQERSQRNEPRARRPQS-GPERECVQERG 287 SP RRR + R R+P+ Q+R R R+ P ARR +S P + Sbjct: 324 SPPARRRRSPSPPARRHRSPTPPARQRRSPSPPARRHRSPPPARRRRSPSPPARRRRSPS 383 Query: 286 PCARRR*IQSEHQQRSR 236 P ARRR S +R+R Sbjct: 384 PPARRRRSPSPLYRRNR 400 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 29.9 bits (64), Expect = 1.6 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHE-QQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR 269 +ERRR K R + SER + ++E +R++ R + G RE ++RG +R Sbjct: 79 RERRRRDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNEKERG-HREHERDRGKDRKRD 137 Query: 268 *IQSEHQQRSRQ 233 + E + + R+ Sbjct: 138 REREERKDKERE 149 Score = 29.5 bits (63), Expect = 2.1 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPER--ECVQERGPCARR 272 KER RDR + +++R + +R + R RR + ER E V+ER RR Sbjct: 119 KERGHREHERDRGKDRKRDREREERKDKEREREKDRERREREREEREKERVKER---ERR 175 Query: 271 R*IQSEHQQRSRQ 233 E +R R+ Sbjct: 176 EREDGERDRRERE 188 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = -1 Query: 445 KERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR* 266 KER + + R+R ER ++R + S+RN R R + G E + RRR Sbjct: 166 KERVKERERREREDGERDRREREK--ERGSRRNRERERSREVGNEESDDDVKRDLKRRRK 223 Query: 265 IQSEHQQRSRQ 233 E +++ R+ Sbjct: 224 EGGERKEKERE 234 >At1g28420.1 68414.m03494 homeobox transcription factor, putative similar to homeobox transcription factor Hox7 GI:19486 [Lycopersicon peruvianum] Length = 1703 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = -1 Query: 418 RDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARRR*IQSEHQQRS 239 R E H + L L+ + ++NE R R+ ERE +E R R + E QR Sbjct: 370 RGSETRENHGPKDLEKLEIQRKKNEERMRKEMERNERERRKEEERLMRERIKEEERLQRE 429 Query: 238 RQ 233 ++ Sbjct: 430 QR 431 >At2g27285.1 68415.m03279 expressed protein weak similarity to maebl (GI:20087019) [Plasmodium falciparum], chimeric erythrocyte-binding protein MAEBL (GI:22086284) [Plasmodium falciparum] Length = 323 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = -1 Query: 442 ERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERG 287 E + KL ++ +E+ E+QR + E ++ R + + PE+E + G Sbjct: 193 EAKEAEKLEEQRKAEKLEEQRKAEKLEELRKEVTRVEKKRKSPEKEVSPDSG 244 >At5g37010.1 68418.m04438 expressed protein Length = 637 Score = 28.7 bits (61), Expect = 3.6 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -1 Query: 451 SPKERRRLTKLRDRNPSERHEQQRLSGLQER-SQRNEPRARRPQSGPER 308 SP+ERRR T R+R+ S+ + SG +ER S N +RR P R Sbjct: 176 SPRERRRRTPSRERDDSKSNR----SGSRERGSSGNGGGSRRVSRSPGR 220 >At4g15180.1 68417.m02328 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 2326 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/61 (27%), Positives = 24/61 (39%) Frame = -1 Query: 451 SPKERRRLTKLRDRNPSERHEQQRLSGLQERSQRNEPRARRPQSGPERECVQERGPCARR 272 SP +R R + RDR+P R + +++ PR RR E P R Sbjct: 431 SPHDRSRYHENRDRSPYARERSPYIFEKSSHARKRSPRDRRHHDYRRSPSYSEWSPHDRS 490 Query: 271 R 269 R Sbjct: 491 R 491 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 104 TTPASPTACQTPTPATSRASTRPA 175 TTP++PT T +PA + +T PA Sbjct: 33 TTPSAPTTSPTKSPAVTSPTTAPA 56 >At2g19710.1 68415.m02303 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 937 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 352 RNEPRARRPQSGPERECVQERGPCARRR-*IQSEHQQRSRQ 233 RNEP RR +S +RE E RR +Q E R+RQ Sbjct: 358 RNEPSHRRDRSNAQRESFSEDHVSPRRNVRMQYEDMDRTRQ 398 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,665,878 Number of Sequences: 28952 Number of extensions: 145085 Number of successful extensions: 601 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 598 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -