BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_N05 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 25 0.64 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.6 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 3.4 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 3.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 3.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 6.0 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.0 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 6.0 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 25.0 bits (52), Expect = 0.64 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 417 FKTLHGLVDKGVKVDLGIPLELWDKPSAEIT-HMKTQCESLLEEN 548 F T HG++DK +VD+ L + + T + +C+S+ E+ Sbjct: 62 FMTKHGILDKNAEVDVQKALRHLPRSMQDSTKKLFNKCKSIQNED 106 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 75 INLRKNIAFYSITTTTPLTKLSFL 4 I LR+ FY++ P +SFL Sbjct: 230 ITLRRKTLFYTVNLIIPCVGISFL 253 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 79 TN*FKEKHCFLFNNNNNTTYKTILF 5 +N +K + +NNN NT YK + + Sbjct: 86 SNNYKYSNYNNYNNNYNTNYKKLQY 110 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 79 TN*FKEKHCFLFNNNNNTTYKTILF 5 +N +K + +NNN NT YK + + Sbjct: 86 SNNYKYSNYNNYNNNYNTNYKKLQY 110 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 79 TN*FKEKHCFLFNNNNNTTYKTILF 5 +N +K + +NNN NT YK + + Sbjct: 86 SNNYKYSNYNNYNNNYNTNYKKLQY 110 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 79 TN*FKEKHCFLFNNNNNTTYKTILF 5 +N +K + +NNN NT YK + + Sbjct: 86 SNNYKYSNYNNYNNNYNTNYKKLQY 110 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 79 TN*FKEKHCFLFNNNNNTTYKTILF 5 +N +K + +NNN NT YK + + Sbjct: 86 SNNYKYSNYNNYNNNYNTNYKKLQY 110 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 79 TN*FKEKHCFLFNNNNNTTYKTILF 5 +N +K + +NNN NT YK + + Sbjct: 86 SNNYKYSNYNNYNNNYNTNYKKLQY 110 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 79 TN*FKEKHCFLFNNNNNTTYKTILF 5 +N +K + +NNN NT YK + + Sbjct: 86 SNNYKYSNYNNYNNNYNTNYKKLQY 110 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 438 VDKGVKVDLGIPLELWDKPSAE 503 +D K+ LG+ LW +PS + Sbjct: 1891 IDSLKKLKLGLRSSLWSRPSTQ 1912 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 438 VDKGVKVDLGIPLELWDKPSAE 503 +D K+ LG+ LW +PS + Sbjct: 1887 IDSLKKLKLGLRSSLWSRPSTQ 1908 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 46 FNNNNNTTYKTILF 5 +NNN NT YK + + Sbjct: 101 YNNNYNTNYKKLQY 114 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 75 INLRKNIAFYSITTTTPLTKLSFL 4 I +R+ FY++ P +SFL Sbjct: 238 ITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 75 INLRKNIAFYSITTTTPLTKLSFL 4 I +R+ FY++ P +SFL Sbjct: 238 ITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 75 INLRKNIAFYSITTTTPLTKLSFL 4 I +R+ FY++ P +SFL Sbjct: 234 ITMRRKTLFYTVNLIIPCMGISFL 257 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +3 Query: 483 WDKPSAEITHMKTQCESLLEENEIXVE 563 W KP + KTQ L E N + E Sbjct: 37 WRKPKPAMVEEKTQLRYLEELNALRTE 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,566 Number of Sequences: 438 Number of extensions: 3119 Number of successful extensions: 21 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -