BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_N04 (860 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ... 29 0.85 SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||... 28 2.0 SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 27 4.5 SPAC1D4.13 |byr1|ste1, ste3|MAP kinase kinase Byr1|Schizosacchar... 26 7.9 SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 2... 26 7.9 SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe... 26 7.9 >SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 962 Score = 29.1 bits (62), Expect = 0.85 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 126 LRESHQYYRAVVRMHLVLL 182 L+ESHQ YR +V +HL LL Sbjct: 297 LKESHQIYRKMVSLHLELL 315 >SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 3971 Score = 27.9 bits (59), Expect = 2.0 Identities = 24/102 (23%), Positives = 39/102 (38%), Gaps = 5/102 (4%) Frame = +3 Query: 264 SIENGVQAKSDGSHKYLSITQGPLPSYAH-----TPGTTIELTCEAAGSPAPSVHWFKND 428 S +N K+D S + T +Y++ T T + T E S + N Sbjct: 244 STQNPTANKTDASQQSTESTSSSASAYSYITTLQTATTAQQTTSENTYSTSGPNLTTSNT 303 Query: 429 SPVYEYDVESNELIDSSPTSIARISSTLIVTRTTSQDVYTCL 554 SP + S+ I SP+ SST +T ++ T + Sbjct: 304 SPQISSTISSSSFIVESPSVALSTSSTTTITNASTPAANTII 345 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 354 PGTTIELTCEAAGSPAPSVHWFKNDSP 434 PG T + TC GS +V++ KN P Sbjct: 427 PGCTYDNTCSQRGSVIANVYFAKNKQP 453 >SPAC1D4.13 |byr1|ste1, ste3|MAP kinase kinase Byr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 340 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 213 QSAHLNKHIKLLSDIDNSIENGVQAKSDGSHKYLSITQ 326 Q AH+N+ +SD+DNS V+ +G+ +S+ + Sbjct: 47 QCAHMNRRPAWISDLDNSSLEVVRHLGEGNGGAVSLVK 84 >SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 244 Score = 25.8 bits (54), Expect = 7.9 Identities = 16/76 (21%), Positives = 32/76 (42%) Frame = +3 Query: 306 KYLSITQGPLPSYAHTPGTTIELTCEAAGSPAPSVHWFKNDSPVYEYDVESNELIDSSPT 485 K+L + + +TPG T ++ +P PS + + ++ + ++ T Sbjct: 8 KFLLLVTAVMAQTEYTPGFTTDVATTVTPTPLPSANVTTTSFSSASTETSTHSVTSTNIT 67 Query: 486 SIARISSTLIVTRTTS 533 SI ST + TT+ Sbjct: 68 SIVPPPSTSHNSTTTT 83 >SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 488 Score = 25.8 bits (54), Expect = 7.9 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 707 HPVADVVHVGAIGDHDARLQREQLSAFRELSSAIC 603 H ++ GAI HD R+ Q+ + SS +C Sbjct: 274 HVLSSGSRSGAIHHHDVRIANHQIGTLQGHSSEVC 308 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,379,215 Number of Sequences: 5004 Number of extensions: 66928 Number of successful extensions: 201 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -