BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_N04 (860 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 27 0.97 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 25 2.2 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 25 2.2 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 5.2 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 5.2 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 24 5.2 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 24 5.2 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 26.6 bits (56), Expect = 0.97 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 824 DQLARAKHLHARVLFNGHILSVEPGDLGLGVSLDAA 717 D RA H H V+ +G + ++P DL +G + AA Sbjct: 249 DPQRRAPHSHHLVIKSGELDLIDPHDLDVGGAAGAA 284 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.4 bits (53), Expect = 2.2 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 5/70 (7%) Frame = +1 Query: 661 SWS--PIAPTWTTSATGWCSRAASRDTPSPRSPGSTDRMCPLKRTRA*RCF---ARASWS 825 +WS P PT TT+ T W A+ TP+P + + + P T + + + Sbjct: 173 TWSDQPPPPT-TTTTTVWTDPTATTTTPAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTT 231 Query: 826 YPPSSGATWT 855 + P++ TW+ Sbjct: 232 HAPTTTTTWS 241 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 25.4 bits (53), Expect = 2.2 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 5/70 (7%) Frame = +1 Query: 661 SWS--PIAPTWTTSATGWCSRAASRDTPSPRSPGSTDRMCPLKRTRA*RCF---ARASWS 825 +WS P PT TT+ T W A+ TP+P + + + P T + + + Sbjct: 173 TWSDQPPPPT-TTTTTVWTDPTATTTTPAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTT 231 Query: 826 YPPSSGATWT 855 + P++ TW+ Sbjct: 232 HAPTTTTTWS 241 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 24.2 bits (50), Expect = 5.2 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 126 LRESHQYYRAVVRMHLVLLFTVAALLGSC 212 ++E +Y V+ + +FT+A +LG+C Sbjct: 491 VKEDWKYVALVLDRLFLWIFTIACVLGTC 519 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 5.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +3 Query: 654 PRIVVSYSTYVDNIGNRVVLPCRVKGHPKPKI 749 PRI Y+ G++ ++ +++ + KPKI Sbjct: 694 PRIEAKNDAYIPKGGDKKIISTKLQWNAKPKI 725 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.2 bits (50), Expect = 5.2 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 663 VVSY-STYVDNIGNRVVLPCRVKGHPKPKI 749 +V Y S Y++NI +R VLP G+ +P I Sbjct: 23 MVDYISNYLENIRDRRVLPTVQPGYLRPLI 52 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.2 bits (50), Expect = 5.2 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 663 VVSY-STYVDNIGNRVVLPCRVKGHPKPKI 749 +V Y S Y++NI +R VLP G+ +P I Sbjct: 54 MVDYISNYLENIRDRRVLPTVQPGYLRPLI 83 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 875,585 Number of Sequences: 2352 Number of extensions: 17399 Number of successful extensions: 40 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -