BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_N02 (674 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC067263-1|AAH67263.1| 974|Homo sapiens exocyst complex compone... 66 1e-10 BC026174-1|AAH26174.1| 474|Homo sapiens EXOC4 protein protein. 66 1e-10 AL831989-1|CAD89977.1| 974|Homo sapiens hypothetical protein pr... 66 1e-10 AK027688-1|BAB55298.1| 974|Homo sapiens protein ( Homo sapiens ... 66 1e-10 AF380839-1|AAK57456.1| 974|Homo sapiens secretory protein SEC8 ... 66 1e-10 AB051486-1|BAB21790.1| 966|Homo sapiens KIAA1699 protein protein. 66 1e-10 AC020602-1|AAY14765.1| 59|Homo sapiens unknown protein. 32 2.1 BC132727-1|AAI32728.1| 1214|Homo sapiens transient receptor pote... 30 6.5 AY297046-1|AAP44475.1| 1069|Homo sapiens transient receptor pote... 30 6.5 AY297045-1|AAP44474.1| 1214|Homo sapiens transient receptor pote... 30 6.5 AY297044-1|AAP44473.1| 1040|Homo sapiens transient receptor pote... 30 6.5 AY046396-1|AAL02142.1| 1040|Homo sapiens TRP-related cation infl... 30 6.5 AK000048-1|BAA90907.1| 1016|Homo sapiens protein ( Homo sapiens ... 30 6.5 AJ575813-1|CAE05941.1| 1214|Homo sapiens transient receptor pote... 30 6.5 AF497623-1|AAM18083.1| 1214|Homo sapiens cation channel TRPM4B p... 30 6.5 >BC067263-1|AAH67263.1| 974|Homo sapiens exocyst complex component 4 protein. Length = 974 Score = 65.7 bits (153), Expect = 1e-10 Identities = 30/66 (45%), Positives = 45/66 (68%) Frame = +3 Query: 156 VKQGKETSGLLMSVIRTLSASETNEQREKERAKLEKEYKKSDARLDELVAVHAQEITDVM 335 V + K+ SGLL+SVIRTLS S+ E RE E+ +LE+ Y+K D LDEL+ H E+T + Sbjct: 14 VSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAI 73 Query: 336 QKFTAV 353 + + ++ Sbjct: 74 RTYQSI 79 >BC026174-1|AAH26174.1| 474|Homo sapiens EXOC4 protein protein. Length = 474 Score = 65.7 bits (153), Expect = 1e-10 Identities = 30/66 (45%), Positives = 45/66 (68%) Frame = +3 Query: 156 VKQGKETSGLLMSVIRTLSASETNEQREKERAKLEKEYKKSDARLDELVAVHAQEITDVM 335 V + K+ SGLL+SVIRTLS S+ E RE E+ +LE+ Y+K D LDEL+ H E+T + Sbjct: 14 VSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAI 73 Query: 336 QKFTAV 353 + + ++ Sbjct: 74 RTYQSI 79 >AL831989-1|CAD89977.1| 974|Homo sapiens hypothetical protein protein. Length = 974 Score = 65.7 bits (153), Expect = 1e-10 Identities = 30/66 (45%), Positives = 45/66 (68%) Frame = +3 Query: 156 VKQGKETSGLLMSVIRTLSASETNEQREKERAKLEKEYKKSDARLDELVAVHAQEITDVM 335 V + K+ SGLL+SVIRTLS S+ E RE E+ +LE+ Y+K D LDEL+ H E+T + Sbjct: 14 VSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAI 73 Query: 336 QKFTAV 353 + + ++ Sbjct: 74 RTYQSI 79 >AK027688-1|BAB55298.1| 974|Homo sapiens protein ( Homo sapiens cDNA FLJ14782 fis, clone NT2RP4000524, highly similar to Mus musculus Sec8 mRNA. ). Length = 974 Score = 65.7 bits (153), Expect = 1e-10 Identities = 30/66 (45%), Positives = 45/66 (68%) Frame = +3 Query: 156 VKQGKETSGLLMSVIRTLSASETNEQREKERAKLEKEYKKSDARLDELVAVHAQEITDVM 335 V + K+ SGLL+SVIRTLS S+ E RE E+ +LE+ Y+K D LDEL+ H E+T + Sbjct: 14 VSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAI 73 Query: 336 QKFTAV 353 + + ++ Sbjct: 74 RTYQSI 79 >AF380839-1|AAK57456.1| 974|Homo sapiens secretory protein SEC8 protein. Length = 974 Score = 65.7 bits (153), Expect = 1e-10 Identities = 30/66 (45%), Positives = 45/66 (68%) Frame = +3 Query: 156 VKQGKETSGLLMSVIRTLSASETNEQREKERAKLEKEYKKSDARLDELVAVHAQEITDVM 335 V + K+ SGLL+SVIRTLS S+ E RE E+ +LE+ Y+K D LDEL+ H E+T + Sbjct: 14 VSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAI 73 Query: 336 QKFTAV 353 + + ++ Sbjct: 74 RTYQSI 79 >AB051486-1|BAB21790.1| 966|Homo sapiens KIAA1699 protein protein. Length = 966 Score = 65.7 bits (153), Expect = 1e-10 Identities = 30/66 (45%), Positives = 45/66 (68%) Frame = +3 Query: 156 VKQGKETSGLLMSVIRTLSASETNEQREKERAKLEKEYKKSDARLDELVAVHAQEITDVM 335 V + K+ SGLL+SVIRTLS S+ E RE E+ +LE+ Y+K D LDEL+ H E+T + Sbjct: 6 VSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAI 65 Query: 336 QKFTAV 353 + + ++ Sbjct: 66 RTYQSI 71 >AC020602-1|AAY14765.1| 59|Homo sapiens unknown protein. Length = 59 Score = 31.9 bits (69), Expect = 2.1 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 Query: 129 LHQRNHPAGVKQGKETSGLLMSVIRTLSASETNEQREKERAK 254 LH+ + G +QG + SGL S A+ TN+QR +R K Sbjct: 5 LHESHKVTGAEQGLQVSGLPDSAAPEGGAAHTNDQRRCQRMK 46 >BC132727-1|AAI32728.1| 1214|Homo sapiens transient receptor potential cation channel, subfamily M, member 4 protein. Length = 1214 Score = 30.3 bits (65), Expect = 6.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 510 QYQLTSVVHSDGFLHPPTIFLGHHVLIVANLCMHPDEP 397 +Y+L HS L PP I + H L++ LC P P Sbjct: 1062 RYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP 1099 >AY297046-1|AAP44475.1| 1069|Homo sapiens transient receptor potential cation channel subfamily M member 4 splice variant protein. Length = 1069 Score = 30.3 bits (65), Expect = 6.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 510 QYQLTSVVHSDGFLHPPTIFLGHHVLIVANLCMHPDEP 397 +Y+L HS L PP I + H L++ LC P P Sbjct: 917 RYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP 954 >AY297045-1|AAP44474.1| 1214|Homo sapiens transient receptor potential cation channel subfamily M member 4 splice variant protein. Length = 1214 Score = 30.3 bits (65), Expect = 6.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 510 QYQLTSVVHSDGFLHPPTIFLGHHVLIVANLCMHPDEP 397 +Y+L HS L PP I + H L++ LC P P Sbjct: 1062 RYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP 1099 >AY297044-1|AAP44473.1| 1040|Homo sapiens transient receptor potential cation channel subfamily M member 4 splice variant protein. Length = 1040 Score = 30.3 bits (65), Expect = 6.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 510 QYQLTSVVHSDGFLHPPTIFLGHHVLIVANLCMHPDEP 397 +Y+L HS L PP I + H L++ LC P P Sbjct: 888 RYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP 925 >AY046396-1|AAL02142.1| 1040|Homo sapiens TRP-related cation influx channel protein. Length = 1040 Score = 30.3 bits (65), Expect = 6.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 510 QYQLTSVVHSDGFLHPPTIFLGHHVLIVANLCMHPDEP 397 +Y+L HS L PP I + H L++ LC P P Sbjct: 888 RYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP 925 >AK000048-1|BAA90907.1| 1016|Homo sapiens protein ( Homo sapiens cDNA FLJ20041 fis, clone COL00423. ). Length = 1016 Score = 30.3 bits (65), Expect = 6.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 510 QYQLTSVVHSDGFLHPPTIFLGHHVLIVANLCMHPDEP 397 +Y+L HS L PP I + H L++ LC P P Sbjct: 888 RYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP 925 >AJ575813-1|CAE05941.1| 1214|Homo sapiens transient receptor potential ion channel melastatin subgroup member 4 protein protein. Length = 1214 Score = 30.3 bits (65), Expect = 6.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 510 QYQLTSVVHSDGFLHPPTIFLGHHVLIVANLCMHPDEP 397 +Y+L HS L PP I + H L++ LC P P Sbjct: 1062 RYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP 1099 >AF497623-1|AAM18083.1| 1214|Homo sapiens cation channel TRPM4B protein. Length = 1214 Score = 30.3 bits (65), Expect = 6.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 510 QYQLTSVVHSDGFLHPPTIFLGHHVLIVANLCMHPDEP 397 +Y+L HS L PP I + H L++ LC P P Sbjct: 1062 RYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSP 1099 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,489,424 Number of Sequences: 237096 Number of extensions: 1852016 Number of successful extensions: 8873 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 8360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8860 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7615267504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -