BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_N02 (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 29 0.041 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 29 0.041 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.0 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 23 2.7 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 23 2.7 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 23 2.7 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 23 2.7 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 23 2.7 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 23 2.7 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 23 2.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 2.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 2.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 2.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 2.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 2.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 2.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 2.7 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 6.1 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 6.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.1 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 29.1 bits (62), Expect = 0.041 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -3 Query: 579 KLRXVHDQLIMIREFHAPKLLHVQYQLTSVV 487 KL +Q I +R++HAP+L + + TS++ Sbjct: 556 KLERTEEQRIALRKYHAPRLAKLALESTSMI 586 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 113 GTMSSPPPTK 142 GT+ SPPPTK Sbjct: 899 GTVVSPPPTK 908 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 29.1 bits (62), Expect = 0.041 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -3 Query: 579 KLRXVHDQLIMIREFHAPKLLHVQYQLTSVV 487 KL +Q I +R++HAP+L + + TS++ Sbjct: 594 KLERTEEQRIALRKYHAPRLAKLALESTSMI 624 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 113 GTMSSPPPTK 142 GT+ SPPPTK Sbjct: 937 GTVVSPPPTK 946 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 603 YLGQLSMYKLRXVHDQLIMIREFHAPKLLHVQ 508 + GQL +YK+ + D + H +H Q Sbjct: 526 FCGQLDVYKVETIGDAYCVACGLHRDTYIHAQ 557 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRE 32 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRE 32 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRE 32 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRE 32 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRE 32 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRE 32 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 10 REYKKKDRRYDQLHNVEEKHLRE 32 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRE 281 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRE 281 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRE 281 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRE 281 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRE 281 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRE 281 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 261 KEYKKSDARLDELVAVHAQEITD 329 +EYKK D R D+L V + + + Sbjct: 259 REYKKKDRRYDQLHNVEEKHLRE 281 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 225 NEQREKERAKLEKEYKKSDARLDE 296 + +RE+ K EKEY+K R E Sbjct: 42 SREREQNSYKNEKEYRKYRERSKE 65 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 225 NEQREKERAKLEKEYKKSDARLDE 296 + +RE+ K EKEY+K R E Sbjct: 42 SREREQNSYKNEKEYRKYRERSKE 65 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 108 IAAQCPLLHQRNHPAGVKQGKETSGLLMS 194 +A C L H R+ P G+E + +L++ Sbjct: 531 MAVACLLFHHRDTPVVRASGRELTIILLA 559 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +3 Query: 108 IAAQCPLLHQRNHPAGVKQGKETSGLLMS 194 +A C L H R+ P G+E + +L++ Sbjct: 621 MAVACLLFHHRDTPVVRASGRELTIILLA 649 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,886 Number of Sequences: 438 Number of extensions: 3382 Number of successful extensions: 30 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -