BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M22 (429 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB) 114 3e-26 At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA... 114 3e-26 At3g14050.1 68416.m01773 RelA/SpoT protein, putative (RSH2) near... 29 1.8 At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) ... 27 4.1 At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containi... 27 4.1 At5g18530.1 68418.m02191 beige/BEACH domain-containing protein c... 27 5.4 At2g35520.2 68415.m04351 defender against cell death 2 (DAD2) id... 27 7.1 At2g35520.1 68415.m04350 defender against cell death 2 (DAD2) id... 27 7.1 At1g32210.1 68414.m03962 defender against cell death 1 (DAD1) id... 27 7.1 At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revo... 26 9.4 At5g51230.2 68418.m06353 embryonic flower 2 (EMF2) identical to ... 26 9.4 At5g51230.1 68418.m06352 embryonic flower 2 (EMF2) identical to ... 26 9.4 >At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB) Length = 105 Score = 114 bits (274), Expect = 3e-26 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 2/101 (1%) Frame = +3 Query: 57 MVNVPKQRRTYXXXXXXXXXXXX--SQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIFXX 230 MVN+PK + TY +QYKK K+ AAQG+RRYDRKQ GYGGQ+KP+F Sbjct: 1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK 60 Query: 231 XXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 353 IVLRL+C CK SQ +KRCKHFE+GGDKK KG Sbjct: 61 KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101 >At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA) similar to ribosomal protein L41 GB:AAA34366 from [Candida maltosa] Length = 105 Score = 114 bits (274), Expect = 3e-26 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 2/101 (1%) Frame = +3 Query: 57 MVNVPKQRRTYXXXXXXXXXXXX--SQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIFXX 230 MVN+PK + TY +QYKK K+ AAQG+RRYDRKQ GYGGQ+KP+F Sbjct: 1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK 60 Query: 231 XXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 353 IVLRL+C CK SQ +KRCKHFE+GGDKK KG Sbjct: 61 KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101 >At3g14050.1 68416.m01773 RelA/SpoT protein, putative (RSH2) nearly identical to RelA/SpoT homolog RSH2 [Arabidopsis thaliana] GI:7141306; contains Pfam profiles PF01966: HD domain, PF04607: Region found in RelA / SpoT proteins Length = 709 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 346 LFLSPPSSKCLHLFNATCDLTLQSAHSRRST 254 L+ SPPSS C +CDL L S S S+ Sbjct: 9 LYASPPSSVCSTPHQISCDLDLTSRSSSTSS 39 >At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) family protein low similarity to Translation initiation factor IF-3 from [subsp. Schizaphis graminum] {Buchnera aphidicola} SP|P46243, {Salmonella typhimurium} SP|P33321; contains Pfam profiles PF05198: Translation initiation factor IF-3 N-terminal domain, PF00707: Translation initiation factor IF-3 C-terminal domain Length = 520 Score = 27.5 bits (58), Expect = 4.1 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +1 Query: 91 AKNVNATKYTRYHSTKSPRKGTLPRVEDVMIVNSRVTVVSPNPSSKR 231 A A R+ P+KG + ++D+ I ++RV SP P S + Sbjct: 238 ADRKGAVVIVRHAKFGPPKKGGVKLMKDIDIKSARVKEESPKPDSSK 284 >At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 798 Score = 27.5 bits (58), Expect = 4.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 126 IPCVLCGIYIFCSTSCAV 73 +PC C I ++CS SC + Sbjct: 275 VPCPSCSIPVYCSESCQI 292 >At5g18530.1 68418.m02191 beige/BEACH domain-containing protein contains 5 WD-40 repeats (PF00400); contains Beige/BEACH domain (Pfam PF02138); FACTOR ASSOCIATED WITH N-SMASE ACTIVATION (FAN) (SP:Q92636) Homo sapiens;similar to Lipopolysaccharide-responsive and beige-like anchor protein (CDC4-like protein) (Beige-like protein) (SP:P50851) [Homo sapiens} Length = 909 Score = 27.1 bits (57), Expect = 5.4 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -1 Query: 192 AVYDHNVFYPG--QRAFPWTFCTVIPCVLCGIYIFCS--TSCAVLVRSPFLSS 46 +VY+ N YP QR + WT IP C IFCS S + L P+ SS Sbjct: 459 SVYEPNE-YPSDMQRLYDWTPDECIPEFYCDPRIFCSLHPSMSDLAVPPWASS 510 >At2g35520.2 68415.m04351 defender against cell death 2 (DAD2) identical to defender against cell death 2 (DAD-2, AtDAD2) [Arabidopsis thaliana] SWISS-PROT:O22622 Length = 116 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 97 FLQYVLRCFGTFTIFEFVRHDINKRQKEHR 8 FL VL C GT + +R +NK KE + Sbjct: 60 FLSGVLSCIGTAVLAVCLRIQVNKENKEFK 89 >At2g35520.1 68415.m04350 defender against cell death 2 (DAD2) identical to defender against cell death 2 (DAD-2, AtDAD2) [Arabidopsis thaliana] SWISS-PROT:O22622 Length = 115 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 97 FLQYVLRCFGTFTIFEFVRHDINKRQKEHR 8 FL VL C GT + +R +NK KE + Sbjct: 59 FLSGVLSCIGTAVLAVCLRIQVNKENKEFK 88 >At1g32210.1 68414.m03962 defender against cell death 1 (DAD1) identical to defender against cell death 1 (DAD-1, AtDAD1) [Arabidopsis thaliana] SWISS-PROT:Q39080 Length = 115 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 97 FLQYVLRCFGTFTIFEFVRHDINKRQKEHR 8 FL VL C GT + +R +NK KE + Sbjct: 59 FLSGVLSCIGTAVLAVCLRIQVNKENKEFK 88 >At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revoluta (REV) / fascicular fiberless 1 (IFL1) identical to HD-zip transcription factor Revoluta (GI:9759333) {Arabidopsis thaliana}; contains Pfam profiles PF01852: START domain and PF00046: Homeobox domain Length = 842 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 193 RVTVVSPNPSSKRRQKPLRKLCSVLS 270 RV P PSS RRQ+ +R+ CS+L+ Sbjct: 39 RVYAECPKPSSLRRQQLIRE-CSILA 63 >At5g51230.2 68418.m06353 embryonic flower 2 (EMF2) identical to embryonic flower 2 [Arabidopsis thaliana] GI:14276050; supporting cDNA gi|14276049|dbj|AB053171.1| Length = 626 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 285 VRSQVALKRCKHFELGGDKKRKGQMIQF 368 +R+ + L+RC H+++ KR+ QM F Sbjct: 60 IRNPLFLQRCLHYKIEAKHKRRIQMTVF 87 >At5g51230.1 68418.m06352 embryonic flower 2 (EMF2) identical to embryonic flower 2 [Arabidopsis thaliana] GI:14276050; supporting cDNA gi|14276049|dbj|AB053171.1| Length = 631 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 285 VRSQVALKRCKHFELGGDKKRKGQMIQF 368 +R+ + L+RC H+++ KR+ QM F Sbjct: 60 IRNPLFLQRCLHYKIEAKHKRRIQMTVF 87 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,304,771 Number of Sequences: 28952 Number of extensions: 158992 Number of successful extensions: 463 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -