BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M17 (837 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 25 3.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 8.7 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.6 bits (51), Expect = 3.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 495 ESLKLYNKHTHYKQ*IKIINTYKLFDCHFYY 587 + L + +HT Y I++ ++LF+ HFYY Sbjct: 925 DPLSIETRHTLYTFNDPILSCFRLFN-HFYY 954 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 550 SILINCLIVIFIMKSLISGLFVLITSASGWNSTVK 654 +IL+NC+++I + V+ T + S VK Sbjct: 161 TILVNCILMIMPTTPTVESTEVIFTGIYTFESAVK 195 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 790,163 Number of Sequences: 2352 Number of extensions: 14153 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -