BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M16 (841 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 229 2e-60 SB_36524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.071 SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) 34 0.17 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) 29 4.7 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 4.7 SB_28863| Best HMM Match : EzrA (HMM E-Value=1.1) 29 6.2 SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) 29 6.2 SB_57025| Best HMM Match : Fascin (HMM E-Value=0) 29 6.2 SB_33399| Best HMM Match : Ank (HMM E-Value=0) 29 6.2 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 28 8.2 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 229 bits (561), Expect = 2e-60 Identities = 107/151 (70%), Positives = 127/151 (84%) Frame = +3 Query: 159 QLLDXYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDHLDNNPALEKL 338 Q LD YPK F+VG DNVGS+QMQ IR SLRG VLMGKNTM+RKAI+ HL+NNP LEKL Sbjct: 1 QYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIRGHLENNPDLEKL 60 Query: 339 LPHIKGNVGFVFTRGDLVEVRDKLLENKVQAPARPGAIAPLSVVIPAHNTGLGPEKTSFF 518 LPHIKGN+GFVFT+ DL +VR ++ENKV APA+ G IAP+ V +PA NTGLGPEKTSFF Sbjct: 61 LPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNTGLGPEKTSFF 120 Query: 519 QALSIPTKISKGTIEIINDVHILKPGDKVGA 611 QAL+IPTKI++GTIEIINDVH++K +K+ A Sbjct: 121 QALAIPTKIARGTIEIINDVHLIKKDEKLKA 151 >SB_36524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 35.1 bits (77), Expect = 0.071 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +3 Query: 273 KNTMMRKAIKDHLDNNPALEKLLPHIKGNVGFVFTRGDL 389 K T++RK +K HLDN P L K LP + G + + + GDL Sbjct: 168 KVTIVRKELKSHLDNLPDLSK-LPDVDGGLAPLPSAGDL 205 >SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) Length = 870 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = -3 Query: 575 IVDDFNSTL*NLGRDRKSLEERGLLWTKAGVVGGNDD*QWG 453 I+D NS + R K+LEERGLL+ +GV GG + ++G Sbjct: 144 IIDGGNSEYKDSMRRCKALEERGLLFVGSGVSGGEEGARYG 184 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = +3 Query: 414 ENKVQAPARPGAIAPLSVVIPAHN--TGLGPEKTSFFQALSIPTKISKGTIEIINDVHIL 587 E ++ +PA +P S+ TGL P S Q LS+ T + ++ D+ Sbjct: 2069 EPRIVSPAGSSLASPTSIATSVITGVTGLHPVTVSHHQPLSVITSLVSASVSSTTDMQNS 2128 Query: 588 KPGDK 602 PG K Sbjct: 2129 TPGKK 2133 >SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) Length = 672 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 481 WAGMTTDNGAMAPGRAGAWTLFSNSL 404 W+ T D PGRA AW+L+S +L Sbjct: 594 WSIATLDGKDQPPGRAWAWSLWSTTL 619 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +2 Query: 173 VPKMFHRGCR*RGLATDAADPYLAT-WLQYRAHGKKHYDA 289 VPKMFH RG+ T+A P + T +L+ R G++ +A Sbjct: 3856 VPKMFHGNRDNRGIKTNAIFPTIITRYLRIRPMGRRGLNA 3895 >SB_28863| Best HMM Match : EzrA (HMM E-Value=1.1) Length = 939 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = -1 Query: 712 ISGAKIVPESYTCLTTRPYENGEMFNMLRRVASEAPTLSPGFKMCTSL--MISIVPFEIL 539 +S + +VP+SY TRP NG+ + + A E P+L+ F+ L +I + I Sbjct: 162 LSVSNLVPDSYFDAFTRPIINGK---VEEKTAGEGPSLATMFEDDRHLQGVIQSIRDAIS 218 Query: 538 VGIERAWK 515 + AWK Sbjct: 219 NAFDMAWK 226 >SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) Length = 2053 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -1 Query: 607 PTLSPGFKMCTSLMISIVPFEILVGIERAWKKEVFSGPR 491 P P F+ C +L+ ++ ++ + RAW+KEV S R Sbjct: 1843 PRNVPNFRACCALVSALSGYQYM---RRAWRKEVISSQR 1878 >SB_57025| Best HMM Match : Fascin (HMM E-Value=0) Length = 504 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/56 (35%), Positives = 27/56 (48%) Frame = +1 Query: 331 RNCCHTSRATLASCSPAETSWRSVTNCWRTKSKLQLVPVPLPHCQSSFPPTTPALV 498 R CCH ++ S AET+ ++ T L+L+P P P P TT ALV Sbjct: 148 RQCCHQQADKISRDSEAETATKTET----PPPWLRLLPAPYPRT----PTTTCALV 195 >SB_33399| Best HMM Match : Ank (HMM E-Value=0) Length = 1416 Score = 28.7 bits (61), Expect = 6.2 Identities = 30/115 (26%), Positives = 44/115 (38%), Gaps = 10/115 (8%) Frame = -1 Query: 757 PAWNLARRSXGLMSRISGAKIVPESY-TCLTTRPYENGEMFNMLRRVASEAPTLSP---G 590 P+ N S L GA P + T T+ PY + AS +PT+SP Sbjct: 1193 PSTNNDPVSQPLFITTPGALFTPLPHETSATSPPYTSASPVPTTTPSASSSPTISPIGSS 1252 Query: 589 FKMCTSLMISIVPFEILVGIERAWKKEVFS------GPRPVLWAGMTTDNGAMAP 443 C+++ P +G ERA ++ S G P++ G NG P Sbjct: 1253 LAQCSTVDSMDKPSLRPIGTERACRRATASPLPSMPGISPLIGGGKLVGNGDSVP 1307 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 28.3 bits (60), Expect = 8.2 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +3 Query: 501 EKTSFFQALSIP---TKISKGTIEIINDVHILKPGDKVGASEATLLNMLNISPFSY-GLV 668 E S Q+ + P T++S G+ + V +KP + G + T ++ N+S S Sbjct: 2269 EPVSIMQSQNTPPVETELSAGSRTSLPKVSAIKPSVEYGQLDDTEIHETNLSASSIPSEK 2328 Query: 669 VKQVYDSGTIFAPEILDI 722 VK ++ S T+ P L I Sbjct: 2329 VKSLFMSSTLDTPSSLSI 2346 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 418 FSNSLSRTSTRSPRVNTKPTLPLMCGNSFSRAGLLSR 308 FS+S + T KP +CG SFS++G LSR Sbjct: 464 FSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSR 500 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,760,836 Number of Sequences: 59808 Number of extensions: 644981 Number of successful extensions: 1795 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1789 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -