BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M16 (841 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. 27 0.94 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 26 1.6 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 25 3.8 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 8.7 >AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. Length = 156 Score = 26.6 bits (56), Expect = 0.94 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 458 IVSRHSRPQHRPWSREDLF 514 +V++ R QHR WS E++F Sbjct: 59 VVAKRVRRQHRDWSDEEIF 77 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 25.8 bits (54), Expect = 1.6 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 479 GGNDD*QWGNGTGTSWSLDFVLQQFV-TDLHEVSAGEH 369 GGND +W + G +W L + FV D H+ G++ Sbjct: 287 GGNDALRWLSNFGEAWRLLASREAFVFVDNHDNQRGDY 324 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 24.6 bits (51), Expect = 3.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 267 MGKNTMMRKAIKDHLDNNPALEKLLPHIKGNVGFV 371 M +NT ++ A+ HL NNP ++ L +K V V Sbjct: 102 MFQNTTLQ-AVLSHLRNNPITDEHLAKVKRGVEIV 135 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.4 bits (48), Expect = 8.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 209 GLATDAADPYLATWLQYRAHGKKHYDAQSHQR 304 G ATD + LA Q + H +H Q HQ+ Sbjct: 293 GSATDNNNYILAQQQQQQHHHHQHQPQQQHQQ 324 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 944,444 Number of Sequences: 2352 Number of extensions: 19727 Number of successful extensions: 33 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -