BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M15 (891 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g13080.1 68414.m01516 cytochrome P450 family protein identica... 31 1.4 At4g04545.1 68417.m00665 Ulp1 protease family protein contains P... 30 1.8 At5g61140.1 68418.m07670 DEAD box RNA helicase, putative similar... 29 5.5 At1g79680.1 68414.m09293 wall-associated kinase, putative simila... 29 5.5 At1g71260.1 68414.m08224 expressed protein 28 7.2 At1g69260.1 68414.m07939 expressed protein 28 7.2 At4g21170.1 68417.m03062 pentatricopeptide (PPR) repeat-containi... 28 9.6 At3g50050.1 68416.m05472 aspartyl protease family protein contai... 28 9.6 >At1g13080.1 68414.m01516 cytochrome P450 family protein identical to gb|D78605 cytochrome P450 monooxygenase from Arabidopsis thaliana and is a member of the PF|00067 Cytochrome P450 family. ESTs gb|Z18072, gb|Z35218 and gb|T43466 come from this gene Length = 502 Score = 30.7 bits (66), Expect = 1.4 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 1/88 (1%) Frame = +1 Query: 295 LNSVTGAPRYC-HKIVMKSGTVVRTCLDVNPNDSQHTCRVVELASNTAIADSAKVKSCAV 471 L+ + G P C HK+ +K G +V L P VV ++S+ A K Sbjct: 44 LHHLAGLPHRCFHKLSIKYGPLVFLRLGSVP--------VVVISSSEAAEAVLKTNDLEC 95 Query: 472 CNKDNCNGAGSISFSLPLATFALIATYF 555 C++ G+G +S+ TFA Y+ Sbjct: 96 CSRPKTVGSGKLSYGFKDITFAPYGEYW 123 >At4g04545.1 68417.m00665 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 882 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = -1 Query: 432 GVGGELDNSAGVLGIV---GVDIQASTDNSSALHDDLVTVSRSSRNAVQDFDRQNVAQVE 262 G+ G D+ AGV GI+ GV TD + D + R + + D D Q+ ++ Sbjct: 442 GLAGGSDSVAGVCGIIGGLGVLDGIKTDTLKEVRGDDASQKRRKKKSSSDMDAQSTRPLK 501 Query: 261 RIE 253 R++ Sbjct: 502 RVK 504 >At5g61140.1 68418.m07670 DEAD box RNA helicase, putative similar to ASC-1 complex subunit P200 [Homo sapiens] GI:12061185; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF02889: Sec63 domain Length = 2146 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -3 Query: 862 TFLFRKLKWNFRYCFKQXCEXYQVFFKISSLMNNIFVRVDGDRCMKMN*DS 710 T+LFR+L N Y + + + +S L+ F ++ C+K+N DS Sbjct: 1775 TYLFRRLMANPAYYGLEGTQDETICSYLSRLVQTTFEDLEDSGCLKVNEDS 1825 >At1g79680.1 68414.m09293 wall-associated kinase, putative similar to wall-associated kinase 2 GI:4826399 from [Arabidopsis thaliana] Length = 769 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 418 LASNTAIADSAKVKSCAVCNKDNCNGAGSISFSLP 522 L N DS K+ ++ N +CNG G SLP Sbjct: 168 LYCNARYGDSEYCKNISIMNDTSCNGIGCCKASLP 202 >At1g71260.1 68414.m08224 expressed protein Length = 238 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 631 VGLGVPNSVLSAPNLVLTEKNSKEFIVNLSSFSYICPHL 747 + L V NS+L + + EF V ++FS+ PH+ Sbjct: 165 ISLSVNNSILKTNDYFVVPVTKAEFAVMKTAFSFALPHI 203 >At1g69260.1 68414.m07939 expressed protein Length = 345 Score = 28.3 bits (60), Expect = 7.2 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = -1 Query: 525 QWEREGNRSSSVTVVLVAHSAGLDLRAVSDRGVGGELDNSAGVLGIVG-VDIQASTDNSS 349 +W N+S +L HSAGLD VS +GG +AG V ++ +AS+D + Sbjct: 179 RWSATANKSG----LLRQHSAGLDSLQVSGESLGG--GRAAGSSSSVSELETKASSDEAR 232 Query: 348 AL 343 +L Sbjct: 233 SL 234 >At4g21170.1 68417.m03062 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 534 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/62 (25%), Positives = 29/62 (46%) Frame = +1 Query: 271 RNILPVEVLNSVTGAPRYCHKIVMKSGTVVRTCLDVNPNDSQHTCRVVELASNTAIADSA 450 R+ L V + R C K + +T L P+ H CRV+E+A+ + + + A Sbjct: 64 RSTLTSPVFLQILRETRKCPKTTLDFFDFAKTHLRFEPDLKSH-CRVIEVAAESGLLERA 122 Query: 451 KV 456 ++ Sbjct: 123 EM 124 >At3g50050.1 68416.m05472 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 632 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 148 CIKCYQCNSEQDKNCGDPFKSAKPPVECN 234 C C QC QD S PV+CN Sbjct: 121 CSDCEQCGKHQDPKFQPEMSSTYQPVKCN 149 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,023,119 Number of Sequences: 28952 Number of extensions: 360674 Number of successful extensions: 870 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2090971320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -