BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M13 (809 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.5 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 3.3 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.8 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.4 bits (48), Expect = 2.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 531 DLPEEFLNCSSGPGGGVIQGSASEATLVGLLV 626 D+PEEFL SG G + SA+ L+ L V Sbjct: 644 DIPEEFLRPESGWAIGAMSFSAT-GILITLFV 674 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.0 bits (47), Expect = 3.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 219 NIRDYDVLPSVEPGYLLRALPESAPE 296 N + DV+ S+E GY L A P PE Sbjct: 841 NWSNQDVIKSIEKGYRLPA-PMDCPE 865 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 303 PVVRVHFQAELLTSNQVQQTAEHHNPLCFQRSS 205 P+V+ HF+ L N+ + H P ++ S Sbjct: 690 PLVKEHFKKALELMNRAVSVPQSHQPGAMEQVS 722 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,349 Number of Sequences: 438 Number of extensions: 4746 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -