BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M11 (829 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60480.1 68418.m07585 zinc finger homeobox family protein / Z... 31 0.71 At5g01240.1 68418.m00031 amino acid permease, putative strong si... 30 1.6 At5g09550.1 68418.m01106 Rab GDP dissociation inhibitor, putativ... 28 6.6 At3g14350.3 68416.m01816 leucine-rich repeat transmembrane prote... 28 6.6 At1g13970.1 68414.m01645 expressed protein 28 6.6 At1g12280.1 68414.m01420 disease resistance protein (CC-NBS-LRR ... 28 6.6 At1g24010.1 68414.m03031 expressed protein 28 8.7 At1g20330.1 68414.m02537 S-adenosyl-methionine-sterol-C-methyltr... 28 8.7 >At5g60480.1 68418.m07585 zinc finger homeobox family protein / ZF-HD homeobox family protein predicted proteins, Arabidopsis thaliana Length = 191 Score = 31.5 bits (68), Expect = 0.71 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +1 Query: 364 PYCRTVLTNPGYMKENFVICIESLHLPDAGDQYNVHELPPEKLKTREVVPI 516 P T+LT+P ++ + C + H D ++ H PP L+ + + P+ Sbjct: 29 PKSTTILTDPPSLRCDACGCHRNFHRRSPSDGFSQHRSPPSPLQLQPLAPV 79 >At5g01240.1 68418.m00031 amino acid permease, putative strong similarity to AUX1 GI:1531758 from [Arabidopsis thaliana]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 488 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -3 Query: 542 DGRGSFAMSMGTTSRVFSFSGGSSWTLYWSPASGKCSDSIHITKFSFM*PGFVSTVL 372 DG G SM + F + GGS+W ++S AS + + + +SF G +S +L Sbjct: 34 DGNGGNGFSM----KSFLWHGGSAWDAWFSCASNQVAQVLLTLPYSFSQLGMLSGIL 86 >At5g09550.1 68418.m01106 Rab GDP dissociation inhibitor, putative strong similarity to GDP dissociation inhibitor protein OsGDI1 [Oryza sativa] GI:2384758; contains Pfam profile PF00996: GDP dissociation inhibitor Length = 365 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Frame = +1 Query: 370 CRTVLTNPGYMKENF--------VICIESLHLPDAGDQYNVHELPPEK 489 C+ V+ +P Y+ E +CI S +PD D ++V + P+K Sbjct: 198 CKKVVCDPSYLSEKVKKVGKVTRAVCIMSHPIPDTNDAHSVQIILPQK 245 >At3g14350.3 68416.m01816 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 1 GB:AAC27894 from [Zea mays] Length = 689 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 215 SKIIHCSVEN-TRLDSTRTRSTIWRPKFRPSSG 310 SKI H EN T+LD ++ IW P+ + + G Sbjct: 467 SKIAHLDHENVTKLDEEESKPLIWNPRVKIALG 499 >At1g13970.1 68414.m01645 expressed protein Length = 504 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +2 Query: 203 RMNRSKIIHCSVENTRLDSTRTRSTIWRPK---FRPSSGYLLRKDLSKYTKKRGT 358 R SK++ SV T +DS T S + +RP +G ++++ L + +G+ Sbjct: 190 RKKSSKVVMVSVRRTSIDSKSTPSEFSSAEKLLYRPKAGSMIQRSLGEKMTSQGS 244 >At1g12280.1 68414.m01420 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 894 Score = 28.3 bits (60), Expect = 6.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 467 TLYWSPASGKCSDSIHITK 411 ++YW P S C +IHITK Sbjct: 815 SIYWQPLSFPCLKTIHITK 833 >At1g24010.1 68414.m03031 expressed protein Length = 141 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 403 KENFVICIESLHLPDAGDQYNVHELPPEKLKT 498 K+ F CIE++ LP + E+P EK KT Sbjct: 18 KKFFQTCIETMDLPKDDVTVEIEEVPLEKKKT 49 >At1g20330.1 68414.m02537 S-adenosyl-methionine-sterol-C-methyltransferase identical to sterol-C-methyltransferase GI:1061040 from [Arabidopsis thaliana] Length = 361 Score = 27.9 bits (59), Expect = 8.7 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +1 Query: 151 AEVSKNETGGGEGIEVIKNEPFKDYPL--LGGKYSSGQYTYKIYHLASKVPAFIRLLAPK 324 A V ET G E++K + P + G+ Y H+ ++ + + + APK Sbjct: 260 AYVDIAETAKKVGFEIVKEKDLASPPAEPWWTRLKMGRLAYWRNHIVVQILSAVGV-APK 318 Query: 325 GSLEVHEEAWNAYPY 369 G+++VHE + Y Sbjct: 319 GTVDVHEMLFKTADY 333 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,870,683 Number of Sequences: 28952 Number of extensions: 385725 Number of successful extensions: 1180 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1180 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -