BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M10 (815 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 25 1.1 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 2.6 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 7.8 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 24.6 bits (51), Expect = 1.1 Identities = 21/70 (30%), Positives = 32/70 (45%) Frame = +1 Query: 175 VLRDGVILCKLANKLAPGSVKKIQERGTNFQLMENIQRFQAAIKKYGVPEEEIFQTADLF 354 + R+ V+L L L SV IQ+ GT F ++RF Y P +E +T + Sbjct: 1 MFREFVLLASLLY-LGNESVHGIQKWGTQFGQAPLLERFFWRTLDYAYP-DEASKTMAMM 58 Query: 355 ERRNIPQVTL 384 + IP+ L Sbjct: 59 KGEYIPENAL 68 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.4 bits (48), Expect = 2.6 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -1 Query: 635 TDINVENIGKNLEAVYMWRVL 573 TDI+ N+ +L+ +Y W+ + Sbjct: 18 TDIHSRNLTNSLKVIYEWKYI 38 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 7.8 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +1 Query: 607 FPIFSTLISVFVHGRI 654 FP+ +I+V +HG++ Sbjct: 8 FPVLFVIINVLLHGQV 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 240,582 Number of Sequences: 438 Number of extensions: 5701 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -