BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M07 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 90 2e-20 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.6 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 22 4.6 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 22 6.1 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 89.8 bits (213), Expect = 2e-20 Identities = 47/128 (36%), Positives = 74/128 (57%), Gaps = 4/128 (3%) Frame = +3 Query: 378 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQT 557 EV V+G + PI FE + ++ + VK GY +PT IQ P+ +SG++L+ AQT Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRDLMSCAQT 204 Query: 558 GSGKTLAYILPAIVHI--NNQPPIRRGD--GPIALVLAPTXELAQQIQQVAAXFGHTSYV 725 GSGKT A++LP I ++ + PP + P+ ++++PT ELA QI F + S V Sbjct: 205 GSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQGKKFAYNSTV 264 Query: 726 RNTCVFGG 749 + ++GG Sbjct: 265 KVAVIYGG 272 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 615 VGYLCAQLLARCRPTFCRN 559 +GY+C + CRP C N Sbjct: 253 LGYICEINVDDCRPGACHN 271 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.2 bits (45), Expect = 4.6 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = +2 Query: 575 GLHLASNCAHK*PTAYSER*WSDCFGLGAYXRVSTTNSASCC--XFWTHILCS*HVCVW 745 G LA N + YS W+D G G Y R + ++T+ LC VC++ Sbjct: 113 GRFLAPNLTYLLVALYSGYVWTDILGFG-YFREYLAEAVQLYFQFYYTYFLCV-IVCIF 169 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 181 GLATVAIDLEDLEALVGKKNSLEGRTCDA 267 G+ +I+ +DL A G KN+L DA Sbjct: 345 GVMIWSIETDDLHATCGTKNALLHAVNDA 373 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,800 Number of Sequences: 336 Number of extensions: 3760 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -