BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M07 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 85 3e-18 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 28 0.27 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 7.7 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 84.6 bits (200), Expect = 3e-18 Identities = 45/126 (35%), Positives = 71/126 (56%), Gaps = 2/126 (1%) Frame = +3 Query: 378 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVGVAQT 557 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G++L+ AQT Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 558 GSGKTLAYILPAIVH-INNQPPIR-RGDGPIALVLAPTXELAQQIQQVAAXFGHTSYVRN 731 GSGKT A++LP I H ++ + + R P +++APT ELA QI F H + ++ Sbjct: 221 GSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKFAHGTKLKV 280 Query: 732 TCVFGG 749 +GG Sbjct: 281 CVSYGG 286 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 28.3 bits (60), Expect = 0.27 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 513 PIAMSGKNLVGVAQTGSGKTLAYILPAIVHINNQPPIRRGDG 638 P+A + K L AQ + ++ I A+V + Q +RR DG Sbjct: 451 PVASNYKTLNYKAQKAAARSHVKIFKALVRLRKQRTLRRNDG 492 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.0 bits (52), Expect = 2.5 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -1 Query: 252 ALQRILFSHQSLQILQ------IYCHRCQTETNYRRIC 157 A +R+ SHQS IL+ I CHRC+ + +R C Sbjct: 180 AQKRMEKSHQSESILRVGPEKKITCHRCRKPGHMKRDC 217 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 330 VLKRSPYEVEEYRNKHEVTVSGVEVHNPIQY 422 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,292 Number of Sequences: 2352 Number of extensions: 15625 Number of successful extensions: 32 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -