BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_M02 (434 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 0.64 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.5 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 6.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 0.64 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 276 RSYHRYXARLRRWCLPHRTHLXRLRSXPXHPPS 374 +++HR C P +L ++ S P HPP+ Sbjct: 66 QAHHRLYPAFSSSCDPVPGNLEQIGSRPLHPPA 98 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 121 LRVAPEEHPVLLTEAPLNPKANREKM 198 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 129 DTQLXVEGVVPDLLHVI 79 + Q V+ V PD+LH+I Sbjct: 21 NNQTVVDKVPPDMLHLI 37 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,400 Number of Sequences: 438 Number of extensions: 1942 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -