BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L19 (842 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1138 - 9429447-9433868 33 0.38 01_01_1214 - 9793854-9794003,9795418-9795456,9795604-9795702,979... 32 0.66 03_05_0328 - 23170019-23170168,23170865-23170903,23171043-231711... 30 2.7 06_01_1058 - 8502401-8502586,8502857-8502917,8503262-8503447,850... 29 6.1 >06_01_1138 - 9429447-9433868 Length = 1473 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 273 CFFFVRETHFEMSRHMGTELGNYKCFSHSADVSNDYH 163 C+ R H S H+G E G ++ +S+ +DV N+ H Sbjct: 280 CYILHRCQHQGTSDHVGGEYGRWQAYSYRSDVYNEIH 316 >01_01_1214 - 9793854-9794003,9795418-9795456,9795604-9795702, 9795779-9795907,9796473-9796619,9797513-9797643, 9798497-9798716,9798858-9798951,9799021-9799133, 9799799-9799903,9800008-9800112,9800762-9800849, 9800933-9801054,9801130-9801189,9802313-9802408, 9802506-9802658,9802752-9802838,9803995-9804062, 9804429-9804552,9805057-9805152,9805250-9805359, 9805459-9805573,9806877-9806942,9807260-9807420, 9807927-9808167 Length = 972 Score = 31.9 bits (69), Expect = 0.66 Identities = 21/72 (29%), Positives = 31/72 (43%) Frame = +3 Query: 603 FSFPITLCFNRDNSFPVHTTSVIL*VFSRIPTNYLTPKPFALMLVLQAFFISSIVKTAAP 782 FS IT N D + VH S + + T T A+ L AF+ ++I P Sbjct: 798 FSSHITFVLNLDTNTFVHIVSTLESGLKGLDTGISTQCASAIDS-LAAFYFNNITAADGP 856 Query: 783 PLPKRITASRHV 818 P P + +RH+ Sbjct: 857 PSPAALNLARHI 868 >03_05_0328 - 23170019-23170168,23170865-23170903,23171043-23171141, 23171214-23171342,23171915-23172061,23172959-23173089, 23173938-23174157,23174294-23174387,23174469-23174581, 23174727-23174861,23175231-23175335,23175440-23175544, 23176240-23176327,23176415-23176536,23176611-23176670, 23177434-23177529,23177620-23177772,23177865-23177951, 23179179-23179246,23179603-23179726,23180235-23180330, 23180430-23180539,23180647-23180761,23181622-23181699, 23181843-23181908,23182203-23182363,23182781-23183099 Length = 1069 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/72 (27%), Positives = 30/72 (41%) Frame = +3 Query: 603 FSFPITLCFNRDNSFPVHTTSVIL*VFSRIPTNYLTPKPFALMLVLQAFFISSIVKTAAP 782 FS IT N D + VH S + + T T A+ L AF+ ++ P Sbjct: 895 FSNHITFVLNLDTNTFVHIVSTLESGLKGLDTGISTQCASAIDS-LAAFYFNNFTAADGP 953 Query: 783 PLPKRITASRHV 818 P P + +RH+ Sbjct: 954 PSPAALNLARHI 965 >06_01_1058 - 8502401-8502586,8502857-8502917,8503262-8503447, 8503531-8503720,8503861-8504212 Length = 324 Score = 28.7 bits (61), Expect = 6.1 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 2/89 (2%) Frame = -1 Query: 698 GRNTREYS*YNRGCMHRKRVIPIEAQSYWE*EIRAFFSYNKFKNGYLYRTWEKILAAFER 519 G+ +E + Y +G +H++++I + A +Y Y KFK G RT EK+L Sbjct: 220 GKTPKEIAEYKKG-LHKEKLITV-AYTY---------QYYKFKGGEQTRTREKLLLPRLE 268 Query: 518 EQDISTPQYV*N--KLLESFI*YQCCYHK 438 Q + N + L FI ++CC+ K Sbjct: 269 RQTSFDDTCITNVQRDLCHFIYHECCHVK 297 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,892,050 Number of Sequences: 37544 Number of extensions: 382120 Number of successful extensions: 735 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2338704516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -