BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L19 (842 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U70854-10|AAB09155.1| 296|Caenorhabditis elegans Hypothetical p... 31 1.4 Z92837-3|CAB07402.3| 502|Caenorhabditis elegans Hypothetical pr... 29 4.1 >U70854-10|AAB09155.1| 296|Caenorhabditis elegans Hypothetical protein F38A5.11 protein. Length = 296 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 714 KPFALMLVLQAFFISSIVKTAAPPLP 791 +P ++L+LQAF +I+++ APP P Sbjct: 2 RPIHIILLLQAFICVTIIQSGAPPFP 27 >Z92837-3|CAB07402.3| 502|Caenorhabditis elegans Hypothetical protein R03E1.3 protein. Length = 502 Score = 29.1 bits (62), Expect = 4.1 Identities = 22/71 (30%), Positives = 36/71 (50%) Frame = +3 Query: 570 FKFIVRKKGPYFSFPITLCFNRDNSFPVHTTSVIL*VFSRIPTNYLTPKPFALMLVLQAF 749 F I+R+ PYFS I FP+ TS+IL + I T+ + L ++LQ++ Sbjct: 249 FGIILRRHLPYFSLSIL--------FPMAGTSLILLLCFWIETHSICFFTIMLNIILQSY 300 Query: 750 FISSIVKTAAP 782 + SS++ P Sbjct: 301 YGSSLLAKMPP 311 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,467,317 Number of Sequences: 27780 Number of extensions: 386352 Number of successful extensions: 777 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2087513582 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -