BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L14 (351 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P67788 Cluster: Adipokinetic prohormone precursor [Cont... 64 6e-10 UniRef50_Q17128 Cluster: Hypertrehalosaemic prohormone precursor... 41 0.005 UniRef50_A3RE77 Cluster: Adipokinetic hormone 2; n=1; Tribolium ... 35 0.33 UniRef50_Q5EY02 Cluster: Adipokinetic hormone preproprotein prec... 33 1.3 UniRef50_A3TL69 Cluster: Putative ABC-type cobalt transport syst... 31 4.1 UniRef50_A7IVH0 Cluster: Putative uncharacterized protein m790R;... 31 5.4 >UniRef50_P67788 Cluster: Adipokinetic prohormone precursor [Contains: Adipokinetic hormone (AKH)]; n=1; Manduca sexta|Rep: Adipokinetic prohormone precursor [Contains: Adipokinetic hormone (AKH)] - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 65 Score = 64.1 bits (149), Expect = 6e-10 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +1 Query: 1 TSSWGGKRAAIAGTVSCRNDESLASIYKLIQXEAEKLLLCQK 126 TSSWGGKRA + ++SCRNDE++A+IYK IQ EAE+ ++CQK Sbjct: 24 TSSWGGKRA-MTNSISCRNDEAIAAIYKAIQNEAERFIMCQK 64 >UniRef50_Q17128 Cluster: Hypertrehalosaemic prohormone precursor [Contains: Hypertrehalosaemic hormone (HTH) (Hypertrehalosaemic neuropeptide); Hypertrehalosaemic hormone precursor-related peptide]; n=1; Blaberus discoidalis|Rep: Hypertrehalosaemic prohormone precursor [Contains: Hypertrehalosaemic hormone (HTH) (Hypertrehalosaemic neuropeptide); Hypertrehalosaemic hormone precursor-related peptide] - Blaberus discoidalis (Tropical cockroach) Length = 72 Score = 41.1 bits (92), Expect = 0.005 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +1 Query: 10 WG-GKRAAIAGTVSCRNDESLASIYKLIQXEAEKLLLCQK 126 WG GKR+A+ + + ESL IYKL+Q EA+K+L C+K Sbjct: 29 WGTGKRSAVQDSPCKGSAESLMYIYKLVQNEAQKILECEK 68 >UniRef50_A3RE77 Cluster: Adipokinetic hormone 2; n=1; Tribolium castaneum|Rep: Adipokinetic hormone 2 - Tribolium castaneum (Red flour beetle) Length = 68 Score = 35.1 bits (77), Expect = 0.33 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = +1 Query: 1 TSSWGGKRAAIAGTVSCRND-ESLASIYKLIQXEAEKLLLCQK 126 T +WG KRA + C+ +++ IYK+IQ EA+KL+ C+K Sbjct: 24 TPNWG-KRAPEGESNRCKESVDTIMLIYKIIQNEAQKLVDCEK 65 >UniRef50_Q5EY02 Cluster: Adipokinetic hormone preproprotein precursor; n=1; Periplaneta americana|Rep: Adipokinetic hormone preproprotein precursor - Periplaneta americana (American cockroach) Length = 70 Score = 33.1 bits (72), Expect = 1.3 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +1 Query: 1 TSSWGGKRAAIAGTVSCRNDESLASIYKLIQXEAEKLLLCQK 126 T +WG KR+ + + E L IYKL++ EA+KL+ C K Sbjct: 26 TPNWG-KRSGLQDGPCKLSTEVLMHIYKLVETEAQKLVECGK 66 >UniRef50_A3TL69 Cluster: Putative ABC-type cobalt transport system, permease component; n=1; Janibacter sp. HTCC2649|Rep: Putative ABC-type cobalt transport system, permease component - Janibacter sp. HTCC2649 Length = 109 Score = 31.5 bits (68), Expect = 4.1 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 87 KFINRRQGFIVPAGHSAGDGSPFS 16 +F+ +R GFI AG A DGSPF+ Sbjct: 41 EFVAKRLGFIDSAGRHASDGSPFA 64 >UniRef50_A7IVH0 Cluster: Putative uncharacterized protein m790R; n=2; Paramecium bursaria Chlorella virus A1|Rep: Putative uncharacterized protein m790R - Chlorella virus MT325 Length = 77 Score = 31.1 bits (67), Expect = 5.4 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 32 SPALCPAGTMNPWRLFINLFXMKLKNSCYARSLKP 136 S ALCPA + PW+ +F ++ +N+ Y + KP Sbjct: 14 SRALCPASMVYPWKENDFIFTIRKQNNTYILTQKP 48 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 271,198,305 Number of Sequences: 1657284 Number of extensions: 4552383 Number of successful extensions: 9189 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9188 length of database: 575,637,011 effective HSP length: 90 effective length of database: 426,481,451 effective search space used: 11088517726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -