BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L14 (351 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222289-1|ABN79649.1| 68|Tribolium castaneum adipokinetic hor... 35 2e-04 EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 21 3.7 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 20 6.4 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 20 6.4 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 20 6.4 >EF222289-1|ABN79649.1| 68|Tribolium castaneum adipokinetic hormone 2 protein. Length = 68 Score = 35.1 bits (77), Expect = 2e-04 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = +1 Query: 1 TSSWGGKRAAIAGTVSCRND-ESLASIYKLIQXEAEKLLLCQK 126 T +WG KRA + C+ +++ IYK+IQ EA+KL+ C+K Sbjct: 24 TPNWG-KRAPEGESNRCKESVDTIMLIYKIIQNEAQKLVDCEK 65 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 21.0 bits (42), Expect = 3.7 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = -3 Query: 70 PRIHRSCRTQC 38 P++H CR++C Sbjct: 79 PQLHNLCRSEC 89 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 20.2 bits (40), Expect = 6.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 Query: 70 PRIHRSCRTQCRR 32 PR R RTQC R Sbjct: 85 PRALRRLRTQCER 97 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 20.2 bits (40), Expect = 6.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 Query: 70 PRIHRSCRTQCRR 32 PR R RTQC R Sbjct: 85 PRALRRLRTQCER 97 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 20.2 bits (40), Expect = 6.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 108 TPAMPEALSRH 140 +PAMP L+RH Sbjct: 131 SPAMPHNLTRH 141 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,035 Number of Sequences: 336 Number of extensions: 1160 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6981810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -